Characterization of diffusion behavior of a novel extra cellular sphingolipid associated peptide probe by fluorescence correlation spectroscopy and imaging total internal reflection fluorescence correlation spectroscopy

... Characterization of Diffusion Behavior of a Novel Extra- cellular Sphingolipid Associated Peptide Probe by Fluorescence Correlation Spectroscopy and Imaging Total Internal Reflection Fluorescence ... cell membrane organization traced by SBD, two new biophysical tool Imaging Total Internal Reflection -Fluorescence Correlation Spectroscopy (ITIR-FCS) and Imaging Total Internal Reflection -Fluorescence ... Thorsten Wohland, and Rachel Kraut Alternate raft pathways cooperate to mediate slow diffusion and efficient uptake of a sphingolipid tracer to degradative vs recycling pathways Journal of Cell Science...

Tài liệu Báo cáo khoa học: Isolation and molecular characterization of a novel D-hydantoinase from Jannaschia sp. CCS1 docx

... A novel high-activity D-hydantoinase from Jannaschia sp CCS1 obtain optically pure amino acids, namely chemical and enzymatic syntheses Chemical synthesis gives racemic mixtures of amino acids ... precipitate fraction; sup, supernatant fraction The molecular weight standard (lane M) is indicated on the right A novel high-activity D-hydantoinase from Jannaschia sp CCS1 Fig Puriﬁcation of HYDBp ... high-activity D-hydantoinase from Jannaschia sp CCS1 Y Cai et al Experimental procedures Genome mining and identiﬁcation of putative D-hydantoinase genes Using the amino acid sequence of HYDBp (AAL37185)...

Tài liệu Báo cáo Y học: Characterization of a novel silkworm (Bombyx mori ) phenol UDP-glucosyltransferase potx

... project A wing disc cDNA library derived from fifth instar B mori C108 larvae was kindly provided by Dr Kawasaki (University of Utsunomiya, Japan) A total of 1000 clones were selected at random and ... the ATG start codon) for cDNA synthesis and 5¢-CCGTGATTGTTGAGTG GATG-3¢ and 5¢-AAGCAACTCCAGTAGACACG-3¢ (position 386–405 and 769–750, respectively, from the ATG start codon) for PCR amplification ... nucleotides of upstream and 54 nucleotides of downstream untranslated sequence A consensus polyadenylation signal (AATAAA) was identified 30 nucleotides downstream of the TAA stop codon The cDNA clone...

Báo cáo khoa học: Molecular and functional characterization of a novel splice variant of ANKHD1 that lacks the KH domain and its role in cell survival and apoptosis docx

... sequence VBARP-L 1.9 VBARP-S 1.3 AACAATGCTGACTGATAGCGGAGGA (Forward) TAAGCTACTACGTAAAGAATATATC (Reverse) GATAAGGTACCTGCACTGACACGGATGAAAGC (Forward) CATATATTCTTTACGTAGTAGCTTA (Reverse) FEBS Journal 272 ... identiﬁed and functionally characterized VBARP, a novel splice variant of ANKHD1 Human ANKHD1 gene is a large transcript containing multiple ankyrin repeat motif domains and a single KH domain similar ... Molecular characterization of ANKHD1 splice variant studies blast searches of VBARP revealed that this protein has homology to human ankyrin repeat and KH domain containing 1 (ANKHD1) variants,...

Báo cáo khoa học: Structural characterization of a novel branching pattern in the lipopolysaccharide from nontypeable Haemophilus inﬂuenzae pot

... Schweda, E.K.H (2001) A rapid and sensitive procedure for determination of 5-N-acetyl neuraminic acid in lipopolysaccharides of Haemophilus in uenzae: a survey of 24 nontypeable H in uenzae strains ... HexNAc1ÆHex5ÆHep4ÆAnKdo-ol (Tables and 4) The Table Negative ion ESI-MS data and proposed compositions for O-deacylated lipopolysaccharide (LPS-OH) of nontypeable Haemophilus in uenzae (NTHi) strain 981 Average ... abundance was estimated from the area of molecular ion peak relative to the total area (expressed as percentage) Peaks representing less than 3% of the base peak were not included in the table Observed...

Báo cáo khoa học: Molecular characterization of a novel nuclear transglutaminase that is expressed during starﬁsh embryogenesis ppt

... ACATGTACATGTATATCACTTTGAACTGGTTTTCATTAAAAAAAAAAAACCATCAATTTG AGAAGAAACAATTACTTCTTAAGTCAATTAATTTTTCTAGAAATGCAAAAGATATTCCCC TTAACAGCTGTTTGAAATGAGGCCTCGGTCTCAAGTTTAAGAGTGCCCCCATATGTAAGC TAAAAAGCTCCAGGAAGTTGACCCAGAAGAAATTTGTTAAGAGTTCACGGATAAGCAAGG ... A H V T L N V K S A * ATGCGAGGTCAGCATTTATCCAACCAGAAGCTTCACGGAGCTAGCTGGGCAAGGAAATTT GATAATCGCAAGAAATAATTTCCCCCCAAAAACAAAAGGTTGTTGGCTGAAAATACTTCT ACATGTACATGTATATCACTTTGAACTGGTTTTCATTAAAAAAAAAAAACCATCAATTTG ... TAAAAAGCTCCAGGAAGTTGACCCAGAAGAAATTTGTTAAGAGTTCACGGATAAGCAAGG TATTTGGATAAGGTGCATTTGTACATTTTGTGTGTACTGGTTTAGTGTAGAATTTAATTT TTTTTGGTTAATTCTGTCACAAGAACATAATTCTATGGTTACTACACAATGTTGCATCCC AACGCCACCTTTTTATTTTTAATCATATATCATCTCAGTGAAGGTCAGTCCTTG...

Báo cáo khoa học: Identiﬁcation and functional characterization of a novel barnacle cement protein pptx

... VPPPCDFSIKSKQKQVGVTAGGASVSAKGATSGSGSITCITKTPTSVTKKVAAGNAGVSG Mrcp19k Bacp19k Bicp19k 70 80 90 100 110 120 TSVSAGDGAFGNLAAALTLVEDTEDGLGVKTKNGGKGFSEGTAAISQTAGANGGATVKKA VSASAANGFFKNLGKATTEVKTTKDGTKVKTKTAGKGKTGGTATTIQIADANGGVSEKSL AAAAAGNGVFKNLVTALTNISTTDDITKVQTQTIGSGGTGGAATILQLADANGGAALKEV ... underwater material surfaces was analyzed by: (a) quantitative amino acid analysis; and (b) SPR Protein adsorption to glass and a positively charged polymer were evaluated by quantification of the ... GC-3¢ and 5¢-AAC TCC GTG GAG AAG AAG AA-3¢ for the first PCR amplification; and 5¢-TGC TGA CCG ACG CGC CTC CT-3¢ and 5¢-GGC AAC ACG GGC GTC ACC GC-3¢ for the second PCR amplification The 102 bp DNA amplified...

Báo cáo khoa học: Characterization of a novel long-chain acyl-CoA thioesterase from Alcaligenes faecalis docx

... MO, USA Bacterial strain The strain isolated from soil samples was identiﬁed as a bacterium, A faecalis according to Bergey’s Manual [31], and was designated A faecalis ISH108 The strain has been ... sample was withdrawn and assayed for activity by the DTNB method using stearoyl-CoA as substrate (c) In an analogous manner, when stearoyl-CoA was used as 2379 Thioesterase of Alcaligenes faecalis ... 8.67 – – 2380 acetate propanoate butanoate hexanoate dodecanoate palmitate stearate FEBS Journal 273 (2006) 2374–2387 ª 2006 IMTECH P Shahi et al Thioesterase of Alcaligenes faecalis Reagent (1 mM)...

Báo cáo khoa học: cDNA cloning and characterization of a novel calmodulinlike protein from pearl oyster Pinctada fucata potx

... nucleotide sequence of oyster CaLP cDNA obtained by RACE, a PCR reaction was performed using a pair of speciﬁc primers P3 (5¢-GGAAGAATACAGACACGGACAG-3¢) and P4 (5¢-ATAACAACAGTTTATACATCGCTTC-3¢) corresponding ... metabolism and calcium signaling pathways Experimental procedures RNA preparation and cDNA synthesis Adult specimens of P fucata were purchased from Guofa Pearl Farm, Beihai, Guangxi Province, China Tissues ... 5¢-untranslated sequence, an open reading frame consisting of 483 bp, a TGA stop, a 146 bp 3¢-untranslated sequence, and a poly (A) tail of 18 nucleotides A putative polyadenylation signals (AATAAA)...

Báo cáo khoa học: Detection and characterization of a novel extracellular fungal enzyme that catalyzes the speciﬁc and hydrolytic cleavage of lignin guaiacylglycerol b-aryl ether linkages pdf

... (Fig 3A) These results indicated that the b-aryl ether cleavage enzyme accumulated and was stable in the extracellular fraction The extracellular fraction of 2BW-1 generated abundant GG and 4MU ... radiolabeled water was not observed with guaiacol It was clear that the b-aryl ether cleavage enzyme catalyzed the addition of two molecules of H2O (at Ca and Cb positions) and cleavage the b-aryl ... cleave the b-aryl ether linkages of GOUbz (III) and GOGbz (IV) In addition, the b-aryl ether cleavage enzyme failed to cleave the b-aryl ether linkage of GOU aO (Fig structure V) Thus, the b-aryl...

Báo cáo Y học: Identiﬁcation and characterization of a novel activated RhoB binding protein containing a PDZ domain whose expression is speciﬁcally modulated in thyroid cells by cAMP pot

... PDZ domain showing 30% identity with the PDZ domains existing in a wide variety of proteins The protein ends by a potential PDZ binding domain motif (SSWY) and contains at least two potential ... presence of activated RhoB (Fig 4D) Regulation of p76RBE mRNA in vitro in thyroid cells As p76RBE was initially isolated from a dog thyroid cDNA library and its mRNA was induced in vivo by thyrotropin ... existence of a Rho -binding domain (HR-1) in the amino terminal part of the protein suggests an implication in transduction pathways involving the Rho proteins By use of the two-hybrid system and...

Báo cáo y học: "The identification and characterization of a novel protein, c19orf10, in the synovium" docx

... staining (g) Intense staining of a hyperplastic RA synovial lining cell layer This staining was typical of most areas of RA synovium where the lining was hyperplastic (h) An area of an RA synovial ... stained positively (arrow) (e) Intense staining of individual cells in the lining layer of a typical OA synovium (f) An area of an OA synovium demonstrates a lining layer completely devoid of ... synovial lining layer and perivascular regions of RA (OCT section) tissue.(b) Intense staining of the synovial lining layer and perivascular regions of OA (paraffin section) tissue (c) An area demonstrating...

Báo cáo y học: "Characterization of a novel and spontaneous mouse model of inflammatory arthritis" pptx

... A, Yamazaki K, Hosono N, Myouzen K, Tsunoda T, Kamatani N, Furuichi T, Ikegawa S, Ohmura K, Mimori T, Matsuda F, Iwamoto T, Momohara S, Yamanaka H, Yamada R, Kubo M, Nakamura Y, Yamamoto K: A ... mice at early and late stages of disease Serum was isolated from AR and NAR littermates, and the levels of six cytokines were measured by cytometric bead array Only (A) IL-6 and (B) TNF -a were ... Comparative Pathology Laboratory at the University of California, Davis An animal necropsy was performed, and numerous organs and tissues were harvested for analysis Sections were examined and...

Báo cáo y học: "Characterization of a novel and spontaneous mouse model of inflammatory arthritis" doc

... 191:313-320 Sakaguchi N, Takahashi T, Hata H, Nomura T, Tagami T, Yamazaki S, Sakihama T, Matsutani T, Negishi I, Nakatsuru S, Sakaguchi S: Altered thymic T-cell selection due to a mutation of the ZAP-70 ... concepts of rheumatoid arthritis Nature 2003, 423:356-361 doi:10.1186/ar3434 Cite this article as: Cuzzocrea S: Characterization of a novel and spontaneous mouse model of inflammatory arthritis Arthritis ... Poly-L-lysine-lysozyme CAIA GPI PLL-L DBA mouse Balb/c mouse DBA mouse Mouse CII antibody Mouse GPI antibody Cationic antigen New animal model Spontaneous Inherited inflamed joints strain IIJ Arthritic male mouse...

Identification and characterization of a novel heart reactive autoantibody in systemic lupus erythematosus possible serological marker for early myocardial dysfunction

... overall incidence was found in Iceland and Japan and highest in USA and France The overall prevalence was the lowest in Northern Ireland, UK and Finland, and the highest in Italy, Spain and Martinique ... IDENTIFICATION AND CHARACTERIZATION OF A NOVEL HEART- REACTIVE AUTOANTIBODY IN SYSTEMIC LUPUS ERYTHEMATOSUS: POSSIBLE SEROLOGICAL MARKER FOR EARLY MYOCARDIAL DYSFUNCTION XU QIAN (M Med., Shanghai ... LIST OF ABBREVIATIONS ACA anticardiolipin antibodies ACR American College of Rheumatology ACHA anticholesterol antibody aCL anticardiolipin antibodies ANA antinuclear autoantibody ANP atrial natriuretic...

Xem thêm

Từ khóa: implementing a characterization of genre the coquette or the history of eliza wharton a novel founded on fact breaking out of bedlam a novel until the end of time a novel danielle steel pdf essentials of organizational behavior by stephen p robbins and timothy a judge 9th edition the behavior of a real gas most closely 423 realizations of a product of sums expression a or and b or and with extra inver 716 functional behavior of a positive edge triggered d flip flop 717 timing behavior of a positive edge triggered d flip flop 725 internal and functional behavior of a master slave s r flip flop 727 internal and functional behavior of a master slave j k flip flop 729 functional behavior of a positive edge triggered j k flip flop 790 typical functional behavior of a pulse catching circuit a characterization of surjective operators micro crack growth behavior in weldments of a nickel base superalloy under biaxial low cycle fatigue at high temperature Báo cáo quy trình mua hàng CT CP Công Nghệ NPV Một số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTP Nghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt nam đề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giải Biện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọ Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDE Quản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninh Phát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninh Nghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúng Tìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tin Chuong 2 nhận dạng rui ro Quản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)BT Tieng anh 6 UNIT 2 Trách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)MÔN TRUYỀN THÔNG MARKETING TÍCH HỢP TÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ QUẢN LÝ VÀ TÁI CHẾ NHỰA Ở HOA KỲ