Báo cáo y học: " Identification of restriction endonuclease with potential ability to cleave the HSV-2 genome: inherent potential for biosynthetic versus live recombinant microbicides" pdf

... cytosine but 5-hydroxymeth-ylcytosine, and most of the hydroxymethylcytosine resi-dues in these DNAs are glycosylated as well [20]. The genome of the B. subtilis phage contains a diversity of ... with potential ability to cleave the HSV-2 genome: inherent potential for biosynthetic versus live recombinant microbicidesMisaki Wayengera*1,2,3,4, Henry Kajumbula1,3 and Wilson Byarugaba1,4Address: ... m6-methyladenine or m6-methylcytosine [19,20]. The aim of this study is to extend our previous work onviral genome slicing (GSX) to HSV-2 by identifying REases(DNases) with potent ability to cleave...

Báo cáo y học: " Identification of a novel linear B-cell epitope in the UL26 and UL26.5 proteins of Duck Enteritis Virus" doc

... appeared to be520IYYPGE525,because any deletion of residues from either end of 520IYYPGE525destroyed the ability of mAb 1C8 to bin d.Comparative analysis of the amino acid sequences of the ... DHPRGRSGGGDDDEAYYPGEG A PAELPP EPLRSRGGG DDEAYYPGEG A PAELPP DQDEPDA DYPYYPGEARGA PRGVDS GRDEPDR DFPYYPGEARPE PRPVDS DYDDRD DAPYYPGEARAP PRVVPDSGGRGRDHDDRD DAAYYPGEARAP RFAPDSAG RDRSIESD LYYPGEFRRSNFSPPQASSMKYEETDKSPEQE ... on the alignment of the structure of UL26 in DEV and HSV-1 [36,39]. The sequence of the epitope is indicated by the yellow bars. Each of the proteins isdesignated by UL26 or UL26.5 plus the...

Báo cáo y học: " Identification of novel transcripts with differential dorso-ventral expression in Xenopus gastrula using serial analysis of gene expression" pptx

... be necessary to address the potential role of these genes in dorso-ventral patterning.Tag-mapping to the genome and tags with no match to transcript databases The availability of the X. tropicalis ... mapped to transcripts with known dorso-ventral expressionand the frequency of appearance for these tags in each library is in agreement with the expressiondescribed by other methods. The other ... described by the inventors of this technique (66%; 131 of 200 orphan tags) [47]. The experimental assignment of thesetags to specific genomic positions may not be useful only to identify novel...

Báo cáo y học: " Detecting sequence polymorphisms associated with meiotic recombination hotspots in the human genome" pptx

... file 3), the vast majority of random P-valuesare uniformly distributed, indicating that they correspond to the truly null hypothesis. Compared with the real case, the set of artificial hotspot-SNP ... <0.01)measured by: (1) the physical distance (in kilobases)from the SNP to the center of the hotspo t; and (2) the number of SNPs between the candidate SNP and the proximal boundary (also a SNP) of the ... 9 of 15 the regulatory role of the 13-mer motif, but also demon-strates the utility of LDsplit to find such motifs.Given the aforementioned restrictions, the LDsplitmethod is not expected to...

Báo cáo y học: "Identification of clinical and simple laboratory variables predicting responsible gastrointestinal lesions in patients with iron deficiency anemia"

... history, and certain laboratory data may guide the choice of which endoscopic investigation to perform first in patients with IDA (especially in pre-menopausal women), thereby, potentially ... assessment of patient characteristics, clinical history, and certain laboratory data may guide the choice of which endoscopic in -vestigation to perform first in patients with IDA, the- reby, potentially ... previous smoking history, coronary artery disease, diabetes mellitus and malignancy history in their family. Statistical Analysis Data files were analyzed initially with Access and SPSS...

Báo cáo y học: "Identification of Cellular Membrane Proteins Interacting with Hepatitis B Surface Antigen using Yeast Split-Ubiquitin System"

... Construction of cDNA Library in S. cerevisiae DSY-2 Strain The cDNA library was prepared by transforming the yeast S. cerevisiae DSY-2 strain, in which the cDNA mixture was combined with pDL2-XN vector ... 5’-AAAACAGAGACCCATATGTAAATTGGTACCAATT-3’ The amplified PCR product was cloned into the binding domain vector pTMBV4 in-frame with Cub (the yeast ubiquitin). The construct was then used to transform yeast S. cerevisiae DSY-1 strain ... Screening System Studies have shown that the use of yeast two hybrid system, which is a genetic assay for in vivo detection of interactions of proteins, enables identification of protein-protein...

Báo cáo y học: "Identification of subpopulations with characteristics of mesenchymal progenitor cells from human osteoarthritic cartilage using triple staining for cell surface markers" docx

... osteoarthritis, in accordance with the terms of the Ethics Committee of the University of Ulm. The age of the donors ranged from 55 to 89 years(mean 74 years). The diagnosis was based on clinical ... fluorescence automated flow cytometry and cell sortingusing typical combinations of cell surface markers for MPCs offer powerful tools with which to study the biologi-cal properties of defined ... split by trypsintreatment (0.05% trypsin, 0.02% EDTA; Biochrom) at 75%confluence.Flow cytometry analysis of cellsEither isolated cells from OC were directly used for flowcytometric analysis...

Báo cáo y học: "Identification of a SmD3 epitope with a single symmetrical dimethylation of an arginine residue as a specific target of a subpopulation of anti-Sm antibodies" ppsx

... antibody sub-populations and by the variety of corresponding epitopes.Recently, two polyclonal antibodies (SYM10, SYM11)were generated that specifically bind to the symmetricalform of dimethylarginine ... majorautoepitope within the carboxyl-terminus of SmD1 [21,22]. The aims of the present study were to develop a peptide-based ELISA system for the detection of anti-Sm antibod-ies and to evaluate the ... subse-quently used to develop an ELISA system based on the general protocol of the Varelisa® tests (PharmaciaDiagnostics).Assay performance characteristics To evaluate the performance of the assay, the...

Báo cáo y học: "Identification of kinectin as a novel Behçet''''s disease autoantigen" doc

... thisstudy further confirms the autoimmune involvement in BD andmay provide new inroads into elucidating the immunopatho-genesis of the disease. In an effort to clarify the association of BD with ... performed the study and drafted the manuscript. PY pro-vided technical help throughout the study. SLC and EMT con-ceived the study, participated in the design and helped in the analysis of the ... because they are commonly used in the labo-ratory as Western blot substrate. Fig. 1 illustrates the commonreactivity to 49 kDa and 120 kDa proteins in the endothelialcell lysates. These antigens...

Báo cáo y học: "Identification of citrullinated α-enolase as a candidate autoantigen in rheumatoid arthritis" doc

... This contrasted with 19% of patients with systemic lupus erythematosus and 15% of patients with systemic sclerosis whose serum samplesreacted with both forms of α-enolase. They hypothesised thatRA ... likely to be present in myeloid cells, the domi-nant cell type in the rheumatoid joint. We therefore studied the promyelocytic HL-60 cell line, which can readily be differenti-ated into cells with ... re-probed with an antibody specific for the carboxy-terminal region of α-eno-lase, we observed a similar pattern to that obtained with serumfrom patients with RA, confirming the identity of the autoantigen.Conversion...

Xem thêm

Từ khóa: Báo cáo quy trình mua hàng CT CP Công Nghệ NPV Biện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọ Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit ĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDE Quản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninh Phối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọ Phát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninh Phát hiện xâm nhập dựa trên thuật toán k means Nghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chế Nghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000 Định tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Thiết kế và chế tạo mô hình biến tần (inverter) cho máy điều hòa không khí Tổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)chuong 1 tong quan quan tri rui ro Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật HIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀM TÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ