0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Báo cáo khoa học >

Báo cáo y học: "The attrition rate of licensed chiropractors in California: an exploratory ecological investigation of time-trend data" docx

Báo cáo y học:

Báo cáo y học: "The attrition rate of licensed chiropractors in California: an exploratory ecological investigation of time-trend data" docx

... noted a doubling of the licensed chiropractors in their Canadian study and a resultantreduction in both doctor/patient ratio and net annualincome. These findings directed our study in Cal ifornia.The ... steady change in residential popula-tion led us to investigate the changes in the number of licensed chiropractors in California since 1970.Changes in the number of licensed chiropractors Mior and ... patients adversely affects thedoctor financially, mirroring the findings in Mior andLaporte’s Canadian study [5].Financial influences on Attrition RatesA decrease in the population-to-chiropractor...
  • 9
  • 355
  • 0
Báo cáo y học:

Báo cáo y học: "The S100A8/A9 heterodimer amplifies proinflammatory cytokine production by macrophages via activation of nuclear factor kappa B and p38 mitogen-activated protein kinase in rheumatoid arthritis" potx

... by cytometric beads array (using anticytokine monoclonal antibody [mAb]-coated beads and phycoerythrin-conjugated anticytokine mAbs). Values are the mean ± standard error of the mean. IL, interleukin; ... pathways, resulting in cytokine production in mono-cytes.Because MAPK inhibitors did not reduce the DNA-bindingactivity of NF-κB, these two critical signaling pathways may beindependently involved ... levelsConclusion In summary, the S100A8/A9 heterodimer, highly expressed bysynovial lining macrophage, may play a role in amplifying proin-flammatory cytokine responses via activation of NF-κB andp38...
  • 12
  • 644
  • 0
Báo cáo y học:

Báo cáo y học: "The association between patellar alignment on magnetic resonance imaging and radiographic manifestations of knee osteoarthritis" ppsx

... magnetic resonance imaging and radiographic manifestations of knee osteoarthritisLeonid Kalichman, Yuqing Zhang, Jingbo Niu, Joyce Goggins, Daniel Gale, Yanyan Zhu, David T Felson and David J ... Foundation, and by an Arthritis Foundation Clinical Sciences Grant. The study sponsor was not involved in study design, in the collection, analysis, and interpretation of data, in the writing of the ... re-assessed intra-rater reliability by inserting one original reliabil-ity scan for every 10 new scans. Before reading each batch of MRIs, LK re-read five previously read MRIs to 'calibrate'...
  • 8
  • 512
  • 0
Báo cáo y học:

Báo cáo y học: "The association between subchondral bone cysts and tibial cartilage volume and risk of joint replacement in people with knee osteoarthritis: a longitudinal study" pptx

... progres-sion was defined simply as an increase in score, and thusincluded both those who had an increase in score andincident cysts. Similarly, cyst regression was defined as adecrease in score, which ... Pelletier2, Johanne Martel-Pelletier2, François Abram3, Yuanyuan Wang1 and Flavia M Cicuttini*1AbstractIntroduction: To examine the natural history of subchondral bone cysts and to determine whether ... was involved in data analyses and manuscript preparation. AEW wasinvolved in manuscript preparation. JPP, JMP, and FA were involved in data col-lection and manuscript revision. YW was involved...
  • 7
  • 425
  • 0
Báo cáo y học:

Báo cáo y học: "The Bruton tyrosine kinase inhibitor PCI-32765 ameliorates autoimmune arthritis by inhibition of multiple effector cells" ppsx

... mobilization, early activation marker and anti-IgM induced cell proliferation in human primary B lymphocytes. (a) Inhibition of intracellular pBtk (Y5 51) and pERK1/2 staining in B cellsfollowing anti-IgM ... Mangla A, Khare A, Vineeth V, Panday NN, Mukhopadhyay A, Ravindran B,Bal V, George A, Rath S: Pleiotropic consequences of Bruton tyrosinekinase deficiency in myeloid lineages lead to poor inflammatoryresponses. ... cytotoxicity byhuman monocytes cultured with recombinant macrophage colony-stimulating factor. Induction of efficient antibody-mediated antitumorcytotoxicity not detected by isotope release assays....
  • 15
  • 334
  • 0
Báo cáo y học:

Báo cáo y học: "The interferon-inducible p47 (IRG) GTPases in vertebrates: loss of the cell autonomous resistance mechanism in the human lineage" docx

... IRGQ1(human) 343 H-Ras-1(human) TIQERLSRYIQEFCLANGYLLP KNSFLKEIFYLKYYFLSLEDKLFKYIKHISSVTGGPV AAVTYYRMAYYLQNLFL SIIAQATSAAEAFCAVKGGPE SSAFQALKVYYRRTQFL SLGEKLLRYVEKFCSVSGGLI ATGVYFRKIFYLQNYFL ... autoimmunity and allergy, arising from the adaptiveimmune system and many others arising from innate immu-nity [42-46]. Indeed, the interferon-inducible dynamin-likeGTPases, the Mx proteins, which ... wasobtained from zebrafish genome resources at the Sanger Cen-tre [67] and analyzed in an Acedb database using the Spanditannotation tool.Chromosomal locations and synteny analysis of mouse andhuman...
  • 18
  • 269
  • 0
Báo cáo y học:

Báo cáo y học: "The Systemic Inflammatory Response Syndrome (SIRS) in acutely hospitalised medical patients: a cohort study"

... Clinically,the Systemic Inflammatory Response Syndrome (SIRS) is identified by two or more symptomsincluding fever or hypothermia, tachycardia, tachypnoea and change in blood leucocyte count. Therelationship ... moderately associated with infection andstrongly related to 28-day mortality.BackgroundSepsis is a systemic inflammatory response to a confirmedor suspected infection. Clinically, the Systemic ... offers more information and givesbetter guidance to the clinician than he or she had in advance.From a clinical epidemiological point of view, a system-atic registration of SIRS status in a patient...
  • 6
  • 698
  • 1
Báo cáo y học:

Báo cáo y học: "κ The TRAF6-NFκB signaling pathway in autoimmunity: not just inflammation" ppsx

... phos-phorylation and eventual degradation of IκB, or processing of ViewpointThe TRAF6-NFκκB signaling pathway in autoimmunity: not justinflammationRanjeny ThomasCentre for Immunology and Cancer ... periphery and in the thymus, the immunesystem must balance antigen presentation and pro-inflammatory outcomes in the periphery in response topathogens and other environmental inflammatory events,along ... [5],the New Zealand Black (NZB) lupus-prone strain [6], and theSKG ZAP70 mutant model of spontaneous arthritis [7], avariety of defects in the interaction of APCs and thymocytesinterfere with...
  • 4
  • 290
  • 0
Báo cáo y học:

Báo cáo y học: "Thymic function and T cell parameters in a natural human experimental model of seasonal infectious diseases and nutritional burden" potx

... Scand J Immunol 1997,45:637-644.54. Yao XS, Diao Y, Sun WB, Luo JM, Qin M, Tang XY: Analysis of the CDR3length repertoire and the diversity of TCR alpha chain in humanperipheral blood T lymphocytes. ... previously showed associations between season -of- birth, thymic size and functional changes during earlyinfancy, with those born during the harvest/low infec-tion season having larger thymi and enhanced ... accompanied by severe thymic atro-phy[17]. In humans, postmortem studies show thymic involu-tion in the severely malnourished[18]. Furthermore,cytokines including IL-7 and IL-2 which are importantfor...
  • 11
  • 527
  • 0
Báo cáo y học:

Báo cáo y học: " Left hepatic trisectionectomy for hilar cholangiocarcinoma presenting with an aberrant biliary duct of segment 5: a case report" pps

... paramedian sector. Simultaneous cholangiography from apercutaneous transhepatic biliary drainage tube in biliary duct of segment 8 and endoscopic nasobiliary drainagetube in biliary duct of segment ... transplantation. In terms of the preoperative recognition of bile-ductanatomy, multi-detector computed tomography scan-ning after drip infusion cholangiography and magneticresonance cholangiography ... Department of Surgery, Graduate School of Medicine, University of Tokyo, 7-3-1 Hongo,Bunkyo-ku, Tokyo 113-8655, Japan.Authors’ contributions AN and SY interpreted the patient images regarding the...
  • 3
  • 229
  • 0

Xem thêm

Từ khóa: báo cáo y họcbáo cáo y học cổ truyềnmẫu báo cáo y học cổ truyềnbao cao y hoc colchicinphan ban luan trong bao cao y hoc co truyenbáo cáo khoa học y họcNghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thốngBáo cáo quy trình mua hàng CT CP Công Nghệ NPVNghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt namNghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoạiNghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THzGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANĐịnh tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)BT Tieng anh 6 UNIT 2Tăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)Tranh tụng tại phiên tòa hình sự sơ thẩm theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn xét xử của các Tòa án quân sự Quân khu (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtNguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)BÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIĐổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namMÔN TRUYỀN THÔNG MARKETING TÍCH HỢP