Báo cáo khoa học: "The long and difficult road to better evaluation of outcomes of prolonged mechanical ventilation: not yet a highway to heave" pdf
Báo cáo khoa học: "The long and difficult road to better evaluation of outcomes of prolonged mechanical ventilation: not yet a highway to heave" pdf
... hospitals had received MV for at least 21 days.CommentaryThe long and difficult road to better evaluation of outcomes of prolonged mechanical ventilation: not yet a highway to heavenAlain Combes1,21Service ... functional status. However, predic-tors of mortality and long- term functional outcomes that are reliable and accurate at the level of the individual patient remain to beidentified.In this issue of ... benchmarkdata, and guiding health care and reimbursement policies.Although information based on DRGs are widely usedbecause they can be easily retrieved from large administrativedatabases, a...
- 2
- 188
- 0
Tài liệu Báo cáo khoa học: The antibacterial and antifungal properties of trappin-2 (pre-elafin) do not depend on its protease inhibitory function pptx
... fromanti-inflammatory, to immunomodulatory, antibacte-rial, antifungal and antiviral functions [1]. SLPI and elafin ⁄ trappin-2 both have antimicrobial activityagainst Gram-negative and Gram-positive bacteria.SLPI ... influenzae, Streptococcus pneumoniae,Klebsiella pneumoniae, Branhamella catarrhalis and thepathogenic fungi A. fumigatus and C. albicans. Ourresults indicate that trappin-2 has a broad antibacte-rial ... N-terminal domain and is comparable to that of human defensins and human lysozyme.Elafin and trappin-2 are both antimicrobial againstS. aureus and P. aeruginosa [14,15] but not againstE. coli...
- 13
- 610
- 0
Tài liệu Báo cáo khoa học: The structure and biological characteristics of the Spirochaeta aurantia outer membrane glycolipid LGLB pdf
... Spirochaetaaurantia LGLBare either branched or unsaturated. Values stated a re theaverage n molÆmg)1with standard deviations (±) obtained fromquantifying and averaging areas under specific peaks ... brennabo-rense,andT. maltophilum appear to have functionalsimilarity to LPS in that t hey possess some ability to gelLimulus amebocyte lysate (LAL) [12,20], a standard assayfor endotoxin activity. In addition, ... oligosac-charides.LGLBdoes not activate any Toll-like receptorThe gelation of LAL is a standard assay based on thenonspecific immune response of the horseshoe crab, and isused to assess the endotoxic potential of various...
- 11
- 632
- 0
Tài liệu Báo cáo khoa học: The diacylglycerol and protein kinase C pathways are not involved in insulin signalling in primary rat hepatocytes doc
... contrast, the available data on hepatic systems arescarce, controversial and have been obtained using primaryadult rat hepatocyte suspensions and cultures, and differenthepatoma cell lines, as model ... that the activation of glycogenFig. 2. Modulation of basal and insulin-stimulated glycogen synthesis by epidermal growth factor (EGF), transforming growth factor a (TGF -a) , ATP and phospholipase ... different hepatocyte preparations.Fig. 3. Total cellular diacylglycerol (DAG) mass of hepatocytes aftertreatment with ATP, phospholipase C (PLC), insulin and epidermalgrowth factor (EGF)/transforming...
- 12
- 592
- 0
Tài liệu Báo cáo khoa học: The isolation and characterization of cytochrome c nitrite reductase subunits (NrfA and NrfH) from Desulfovibrio desulfuricans ATCC 27774 Re-evaluation of the spectroscopic data and redox properties ppt
... compriseCytc_DdesCytc_DgigNrfH_WsucNrfH_SdelNrfH_DdesCymA_SputNapC_RsphNapC_PpanNapC_AbraNapC_Paer VDAPADMV.IKAPAGAKVTKAPV AFSHKGHASM VDVPADGAKIDFIAGGE.KNLTV VFNHSTHKDV MNKSKFLVYSSLVVFAI ALGLFVYLVNASKALSYLSSDPKACI NCHVM. NPQYAT MKNSNFLKYAALGAFIVAIGFFVYMLNASKALSYLSSDPKACI ... highmolecular mass bands (not shown). Such electrophoreticbehavior suggests that the bands at approximately 110 and 37 kDa correspond to strongly attached dimers of bothNrfA (a 2)andNrfH(b2), ... Gabriela Almeida1, So a Macieira2, Luisa L. Gonc¸alves1, Robert Huber2, Carlos A. Cunha1,Maria Joa˜o Roma˜o1, Cristina Costa1, Jorge Lampreia1, Jose´J. G. Moura1 and Isabel...
- 12
- 593
- 0
Tài liệu Báo cáo khoa học: "The Structure and Process of Talking About Doing" pdf
... name tank. Than %e the evaluatAon 5eat oemmon%y used today For strafe.sial AntelIA|enee models. A more r~l;orous 5eat %e 5n Cry to F~.5 a mode/. 50 • emma OF data. ?hAs ~e the evaluate.on ... so+lYe a oct+sAn aununS, with a oor~aAn smotmt oF nalIAenoln, and ~he more oaIAent a preoeaa As, 5he lar|er %5e %npae5 on oSher presences (and therefore on the overall prooeaoLng). There ... " One XntoreatAng ~Ant about 5h ~a ~rt~e~ar example %8 5hat ~t %e embedded wlthAn an "el~mlnatAon of alternat£voo" arll~Nnt etruoture. The5 %a, 5hAm "prqitAo arluaent"...
- 4
- 584
- 0
Báo cáo khoa học: The chaperone and potential mannan-binding lectin (MBL) co-receptor calreticulin interacts with MBL through the binding site for MBL-associated serine proteases pdf
... generally accepted that the MASPs are activatedupon binding of MBL to its targets and that this initi-ates activation of the complement cascade, leading to target lysis and/ or opsonization. Inactivation ... G, Gal P, Kojima M, Szilagyi K, Balczer J,Antal J, Graf L, Laich A, Moffatt BE, Schwaeble Wet al. (2003) Natural substrates and inhibitors of man-nan-binding lectin-associated serine protease-1 ... the same buffer with the addition of 1% Tri-ton X-114. A separation of water and detergent phases of the last two supernatants was induced by addition of Triton X-114 to 2% and incubation at 37...
- 12
- 429
- 0
Báo cáo khoa học: "THE MACHINE AND THE MAN" pot
... designer and creator of the machine; but let us not be so demanding as to say that he must create the machine and the translation system in its final form before the switch is thrown and the machine ... availability of mechanical translations of the most important foreign scientific and cul- tural writings is bound to have a great effect upon international communication and under-standing; ... can translate some things, but not all things. To be specific: the machine may have only a limited vocabulary; it may be able to handle only a limited number of gram- matical or syntactic...
- 3
- 253
- 0
Báo cáo khoa học: "THE SYNTAX AND SEMANTICS OF USER-DEFINED MODIFIERS IN A TRANSPORTABLE NATURAL LANGUAGE PROCESSOR" pot
... grammatical formalism for transportable natural language processing, llm~r. J. Cow~p~t~zt~na~ L~n~ist~cs, to appear. Biermann, A. and Ballard, B. Toward natural language computation. Am~r. ... portable natural language data base interface. Cmlf. on Ap'1)lied Nc~t~ral L~znguage Processing, Santa Munica, Ca., 1983, pp. 25-30. 25. Grosz, B. TEAM: A transportable natural language ... .~tell~qTence, Stanford univ., Palo Alto, Ca., 1980, pp. 235- 239. 27. Hendrix, G. and Lewis, W. Transportable natural-language interfaces to databases. Proc. 19th A~ z~t Meet~w of the ACL, Stanford...
- 5
- 452
- 0
Báo cáo khoa học: "The Formal and Processing Models of CLG" docx
... and (b) the intermediate and final data structure are also partial descriptions, being potentially annotated with unresolved constraints, and denote not a single, but a class of representations. ... is no guarantee that all constraints will always be solved, not even after the last rewrite to normal lotto. As a result (a) the system does not fail because all constraints have not been ... things a compact representation of partial objects. Finally we have emphasized the importance of lazy evaluation of complex constraints in order to ensure computational tractability. Acknowledgement...
- 6
- 281
- 0
Từ khóa: Báo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018Một số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTPGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANPhối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọTrả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Phát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngĐịnh tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Thiết kế và chế tạo mô hình biến tần (inverter) cho máy điều hòa không khíTổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)Quản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)Tăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtGiáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtĐổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namQUẢN LÝ VÀ TÁI CHẾ NHỰA Ở HOA KỲ