Báo cáo y học: " Family Structure and Posttraumatic Stress Reactions: A Longitudinal Study Using Multilevel Analyses" docx
Báo cáo khoa học: Crystal structure and enzymatic properties of a bacterial family 19 chitinase reveal differences from plant enzymes pdf
... Pseudomonas aeruginosa. Althoughmany plant family 19 chitinases are known, crystal structures are available for only two of these [9,15–17].The first structure of a bacterial family 19 chitinase has ... T, Yokokawa S, Saito A, Fujii T, Nikaidou N,Miyashita K & Watanabe T (2006) Comparison of enzymatic and antifungal properties between family 18 and 19 chitinases from S. coelicolor A3 (2). ... 4895 Crystal structure and enzymatic properties of a bacterial family 19 chitinase reveal differences from plant enzymes Ingunn A. Hoell1, Bjørn Dalhus2, Ellinor B. Heggset1, Stein I. Aspmo1and...
- 12
- 399
- 0
Báo cáo Y học: Purification and characterization of VanXYC, a D,D-dipeptidase/D,D-carboxypeptidase in vancomycin-resistant Enterococcus gallinarum BM4174 docx
... polymerase(Stratagene) was used to amplify vanXYCusingpAT704astemplate with primers A (5Â-GCTAGGTCTCAATGAACACATTACAATT-3Â)andB(5Â-TATGGAATTCTCATGCGAACTGCCTCA-3Â) that included BsaIandEcoRIrestriction ... molecular mass standards; lane 2, cytoplasm containingMBP-VanXYC;Lane3,MBP–VanXYCafter amylose resin chroma-tography. (C) Purification of His6–VanXYC. Lane 1, molecular massstandards; lane ... SDS/PAGE analysis. (A) Purification of VanXYC.Lane1,molecular mass standards (in kDa); Lane 2, partially pure VanXYCafter gel filtration chromatography. (B) Purification of MBP-VanXYC.Lane...
- 7
- 414
- 0
Báo cáo Y học: Purification and catalytic properties of a CO-oxidizing:H2-evolving enzyme complex from Carboxydothermus hydrogenoformans doc
... the purification and catalytic proper-ties of a membrane-bound enzyme complex from C. hydro-genoformans composed of a hydrogenase and a COdehydrogenases. The complex catalyzes the conversion of CO ... Fe-containing catalytic subunit of CO dehydrogenase. A catalytically active CooSIdimer has been previously purified and characterized from C. hydrogenoformans [25]. The 89- and 62-kDa polypeptideswere ... to an apparent molecular mass of 120 kDa.Protein was concentrated by ultrafiltration and analyzed bySDS/PAGE.Determination of enzyme activitiesThe assays were routinely carried out under anoxic...
- 10
- 376
- 0
Báo cáo Y học: Heterologous expression and folding analysis of a b-tubulin isotype from the Antarctic ciliate Euplotes focardii ppt
... expression and folding analysis of a b-tubulin isotype from the Antarctic ciliate Euplotes focardii Sandra Pucciarelli1,2, Cristina Miceli1 and Ronald Melki21Dipartimento di Biologia Molecolare, ... eukaryotes, an isotype of b-tubulin (b-T1) from the Antarctic ciliate Euplotes focardii, was expressed in Escherichia coli. Folding analysis was performed by incubation of the 35S-labeled, denaturedb-T1 ... protozoa, CCT has been characterized at the genesequence level in the ciliate Tetrahymena pyriformis [19,20],in the diplomonadide Giardia lamblia and the parabasilideTrichomonas vaginalis [21]. From...
- 7
- 500
- 0
Báo cáo Y học: Chemical structure and immunoreactivity of the lipopolysaccharide of the deep rough mutant I-69 Rd–/b+ of Haemophilus influenzae docx
... ể FEBS 2002 Chemical structure and immunoreactivity of the lipopolysaccharide of the deep rough mutant I-69 Rd/b+ of Haemophilus inuenzaeSven Muă ller-Loennies, Lore Brade and Helmut BradeResearch ... Medicine and Biosciences, Borstel, GermanyFrom the lipopolysaccharide of the deep rough mutant I-69 Rd–/b+ of Haemophilus influenzae two oligosaccharideswere obtained after de-O-acylation and ... leadingto the induction of protective a ntibodies; and (d) the understanding of the biosynthesis of LPS may allow the distinct blockage of e ssential steps as a new strategyfor the development of antibiotics...
- 6
- 372
- 0
Báo cáo y học: " Phosphatidylserine receptor and apoptosis: consequences of a non-ingested meal" pptx
... hypotheses.Disposing of dying cell: a fine balancebetween proinflammatory and anti-inflammatory signalsPhagocytosis of apoptotic cells is known to be an anti-inflammatory [15] and immunologically silent ... thatdifferent phagocytic receptors may cooperate with eachother and function as a team. Some receptors may simplyplay a role in tethering of phagocyte to apoptotic cellswithout generating a ... the cells and their safe disposal byprofessional (macrophages and immature dendritic cells) and nonprofessional (such as fibroblasts and epithelialcells) phagocytes [1]. The removal of apoptotic...
- 4
- 332
- 0
Báo cáo y học: "ITGAV polymorphism and disease susceptibility in a Japanese rheumatoid arthritis population" ppsx
... Inoue E, Toyama Y, Hara M, Yamanaka H,Tomatsu T, Momohara S, Kamatani N: Failure to confirm associ-ation between PDCD1 polymorphisms and rheumatoid arthri-tis in a Japanese population. J Hum Genet ... with rheumatoid arthritis in the European Caucasian population: a family-based study. Arthritis Res Ther 2007, 9:R63.2. Friedlander M, Brooks PC, Shaffer RW, Kincaid CM, Varner JA,Cheresh DA: ... S, Alibert O, Quillet P,et al.: Dense genome-wide linkage analysis of rheumatoid arthritis, including covariates. Arthritis Rheum 2004, 50:2757-2765.5. Iwamoto T, Ikari K, Inoue E, Toyama Y, ...
- 2
- 313
- 0
Báo cáo y học: "Sleep structure and sleepiness in chronic fatigue syndrome with or without coexisting fibromyalgia" pdf
... sleep structures and subjective scoreson visual analog scales for sleepiness and fatigue in CFSpatients with or without coexisting fibromyalgia (n = 12 and 14,respectively) with 26 healthy subjects. ... quality perception in the chronic fatigue syndrome: correlations with sleep efficiency, affectivesymptoms and intensity of fatigue. Neuropsychobiology 2007,56:40-46.13. University of Medicine and ... correlated (P < 0.05) in both patients and controls. Sig-nificant correlations were found for pain and fatigue reported in the evening and morning for patients but only in the eveningfor...
- 10
- 454
- 0
Báo cáo y học: "Biologic activity and safety of belimumab, a neutralizing anti-B-lymphocyte stimulator (BLyS) monoclonal antibody: a phase I trial in patients with systemic lupus erythematosus" potx
... study of belimumab in SLE patients with stable, mild to moderate disease activity and demonstrated its safety, biologic activity, and pharmacokinetics.Materials and methods Patients Patients aged ... work is properly cited.AbstractIntroduction This trial evaluated the safety, biologic activity, and pharmacokinetics of belimumab, a fully human monoclonal antibody that inhibits the biologic activity ... urticaria during the administration of a 20 mg/kgsingle dose. The infusion was discontinued approximately 40minutes after initiation, and the urticaria and chest painresolved with two doses of...
- 15
- 478
- 0
Báo cáo y học: " De novo genome sequence assembly of a filamentous fungus using Sanger, 454 and Illumina sequence data" ppsx
... Forge assemblies were generated using Illumina, 454 and Sanger read data. The &apos ;454& apos; assembly was generated using only 454 SE read data. The 'Sanger -454& apos; assembly was generated ... combining Illumina, 454 and Sanger sequence data.BackgroundThe efficiency of de novo genome sequence assembly proc-esses depends heavily on the length, fold-coverage and per-base accuracy of the sequence ... sheared genomic DNA frag-ments on an Illumina GAii (approximately 3.3 Gb of sequence data; approximately 100-fold genome sequence coverage).Initial assembly analysisInitially, Illumina PE...
- 12
- 620
- 0
Báo cáo y học: "HIV, appendectomy and postoperative complications at a reference hospital in Northwest Tanzania: cross-sectional study" doc
... with append icitis in Tanzania, and are associated withsevere morbidity, postoperative complications and longer hospital stays. Early diagnosis of appendicitis and prompt appendectomy are crucial ... referral centre for tertiary specialist care f or a catchment population of approximately 13 millionpeople from Mwanza, Mara, Kagera, Shinyanga, Tabora and Kigoma regions of Tanzania.Study populationWe ... 1:252-255.18. Tanzania HIV/AIDS and Malaria Indicator Survey 2007-08: PreliminaryReport. Tanzania Commission for AIDS (TACAIDS).27.19. Alvarado A: A practical score for the early diagnosis of acuteappendicitis....
- 6
- 345
- 0
Báo cáo y học: "Rationale, design and methodology for Intraventricular Pressure Gradients Study: a novel approach f" doc
... outflow-tract pressure gradient and apical and basal myocardial segments lengthening changes at basal, afterloaded and ischemic conditions. Afterload increase will be performed by abruptly narrowing ... pulmonary dis-ease that are worse than mild as assessed clinically and/ or confirmed by pulmonary function testing. (Table 1)The baseline and follow-up clinical variables and pharmacological data are ... 6:67http://www.cardiothoracicsurgery.org/content/6/1/67Page 3 of 6 STUDY PROT O C O L Open AccessRationale, design and methodology for Intraventricular Pressure Gradients Study: a novel approach for ventricular...
- 6
- 377
- 0
Báo cáo y học: " Family Structure and Posttraumatic Stress Reactions: A Longitudinal Study Using Multilevel Analyses" docx
... 4 Family Structure and Posttraumatic Stress Reactions: A Longitudinal Study Using Multilevel Analyses Background There has been increasing interest in the relevance of family factors ... the article as it appeared upon acceptance. Fully formattedPDF and full text (HTML) versions will be made available soon. Family Structure and Posttraumatic Stress Reactions: A Longitudinal Study Using ... 1998 landslide in Sarno, Italy: A community study. Acta Psychiatrica Scandinavica 2001, 104(6):438-442. 4. Fullerton CS, Ursano RJ, Kao TC, Bharitya VR: Disaster-related bereavement: Acute symptoms...
- 28
- 253
- 0
Báo cáo y học: "PEEP titration guided by ventilation homogeneity: a feasibility study using electrical impedance tomography" ppt
... MP, Tanaka H, Sipmann FS, Santos DC, Barbas CS, Carvalho CR, Amato MB: Imbalances in regional lung ventilation: a validation study on electrical impedance tomography. Am J Respir Crit Care Med ... et al., PEEP titration guided by ventilation homoge-neity: a feasibility study using electrical impedance tomography Critical Care 2010, 14:R8 Zhao et al. Critical Care 2010, 14:R8http://ccforum.com/content/14/1/R8Page ... frequency domain, is subsequently subtracted. As a result a quasi-symmetric left and right lung area is gener-ated that includes all detectable lung area and thatexcludes the cardiac-related area.The...
- 8
- 245
- 0
Báo cáo y học: " Functions, structure, and read-through alternative splicing of feline APOBEC3 genes" ppt
... KVHPWARCHAEQCFLSWFRDQYPYRDEYYNVTWFLSWSPCPTCAEEVVEFLEEYRNLTLS 120A3Cb KVHPWARCHAEQCFLSWFRDQYPYRDEYYNVTWFLSWSPCPTCAEEVVEFLEEYRNLTLS A3Cc KVHPWARCHAEQCFLSWFRDQYPCRDEYYNVTWFLSWSPCPTCAEEVVEFLEEYRNLTLS A3Ca IFTSRLYYFWDPNYQEGLCKLWDAGVQLDIMSCDDFKHCWDNFVDHKGMRFQRRNLLKDY ... 5Expression analysis of feline A3C, A3H and A3CH. (a,b) Analysis of expression of feline A3C, A3H and A3CH by RT-PCR of total RNA from feline cell lines (CrFK, MYA-1, KE-R) and feline PBMCs (a) and expression ... of feline, canine and human APOBEC3 proteins. (a) Amino acid alignment of feline APOBEC3Ca, APOBEC3Cb, APOBEC3Cc, human APOBEC3C, APOBEC3F and murine APOBEC3 NT. (b) Amino acid alignment of feline, ...
- 20
- 264
- 0
Từ khóa: Nghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thốngBáo cáo quy trình mua hàng CT CP Công Nghệ NPVNghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt namNghiên cứu tổ hợp chất chỉ điểm sinh học vWF, VCAM 1, MCP 1, d dimer trong chẩn đoán và tiên lượng nhồi máu não cấpNghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt namGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitNGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDEPhát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninhPhát triển du lịch bền vững trên cơ sở bảo vệ môi trường tự nhiên vịnh hạ longNghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000Sở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIXChuong 2 nhận dạng rui roTổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)BT Tieng anh 6 UNIT 2Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)Đổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namQUẢN LÝ VÀ TÁI CHẾ NHỰA Ở HOA KỲ