báo cáo khoa học: " Benefits of global partnerships to facilitate access to medicines in developing countries: a multi-country analysis of patients and patient outcomes in GIPAP" pps
Báo cáo khoa học: "High-dose chemoradiotherapy followed by surgery versus surgery alone in esophageal cancer: a retrospective cohort study" doc
... MH, and AV assisted in the conception and design of the study. MHassisted in the collection and assembly of the data. MH, TWL, AV and KØassisted in data analysis and interpretation. MH, AV, ... resections.Response to CRTComparison of stage of disease before and after treatment in 31 operated CRT patients demonstrated down-staging in 58%, no change in 23% and up-staging in 19% of the patients (Figure ... thrombo-cytopenia (20 patients) and reduced performance status(20 patients) .CRT toxicities that occurred as grade 3 only wereesophagitis (35 patients) , stomatitis (12 patients) ,anorexia (23 patients) ,...
- 9
- 213
- 0
báo cáo khoa học: " Effective continuing professional development for translating shared decision making in primary care: A study protocol" docx
... theway that patients are engaged as partners in their healthcare [6]. Shared decision making (SDM) is an interactiveprocess by which patients and practitioners collaborate in choosing health care. ... transferability o f the pro-gram to other healthcare professionals and contexts; and updates, modifications, and revisions.Inventory of CPD programs for translating SDM in clinicalpractice A ... perspectives of our multidisciplinary team members.We acknowledge that a wide range of interventions atvarious levels in healthcare systems, within organisations, and with patients and healthcare professionals...
- 6
- 296
- 0
báo cáo khoa học: "Pathological complete response after neoadjuvant chemotherapy with trastuzumabcontaining regimen in gastric cancer: a case report" ppsx
... original ulcerative tumor site, and laparoscopyrevealed no evidence of peritoneal carcinomatosis ormetastatic implants. Pathological examination of thesurgical specimen indicated no residual adenocarcinomabut ... M, Jensen HA, Vestermark LW,Pfeiffer P: Phase I study of docetaxel, oxaliplatin and capecitabine (TEX)as first line therapy to patients with advanced gastro-oesophagealcancer. Acta Oncol 2010.20. ... 4 of 4 and patient was recommended to receive neoadjuvantchemotherapy before definitive surgery. The information of ToGA trial was presented to patient [6], and patient agreed to receive trastuzumab-containing...
- 4
- 286
- 0
báo cáo khoa học: "Malignant papillary peritoneal mesothelioma presenting as recurrent adhesion obstruction in general surgery: a case report" potx
... of pleural mesothelioma [4]. An abdominal CT scanexamination may show the presence of ascitic fluid and peritoneal thickening [5], and calretinin immu-nostaining of ascitic fluid can be done. ... onpresentation and plain abdo minal radiographs. The patient underwent an exploratory laparotomy and a diagnosis of adhesions without obvious obstruction wasdiagnosed, but no biopsy taken.He ... [1].Pathologically, patients present with tumors of thepleura (pulmonary) and peritoneum and, less frequently,the pericardium and the tunica vaginalis [1]. Owing to the r arity and aggressive nature of...
- 4
- 301
- 0
báo cáo khoa học: " Packaged water: optimizing local processes for sustainable water delivery in developing nations" pptx
... world.ConclusionPackaged water made available in sachets, like otherlocal initiatives offer substantial hope in contributing to increased sustainable access in rural and urban settingsDada Globalization and Health ... is to halve the propor tion of people withoutsustainable access to portable water and basic sanitation.Today, more than halfway into the deadlines, availablefigures reveal a large disparity ... disposal of plastic waste and how to managesuch waste. In addition to this, an Accra based NGO,focusing on sustainability and the environment hastaken on the task of cleaning up the streets of Accra.They...
- 8
- 237
- 0
báo cáo khoa học: " Benefits of global partnerships to facilitate access to medicines in developing countries: a multi-country analysis of patients and patient outcomes in GIPAP" pps
... HealthOpen Access Research Benefits of global partnerships to facilitate access to medicines in developing countries: a multi-country analysis of patients and patient outcomes in GIPAPPanos ... El Salvador and Mexico fromLatin America; Russia and Georgia from Europe; China,India, Malaysia, Pakistan and Thailand from Asia. In theChinese context, each of China's provinces and ... 9( 4A2 6 -A4 4[http://www.who.int/hiv/AAI_fs_4Q2005.pdf].12. Accelerating Access Initiative (AAI, 2006): AAI - Fact Sheet. .accessed 20 April 200913. Lassarat S, Jootar S: Ongoing challenges of a global interna-tional patient assistance program. Annals...
- 13
- 292
- 0
Báo cáo khoa học: Alternative splicing: global insights potx
... proteins that are targets of a neuronal autoimmuneresponse associated with cancer. Analysis of theseproteins in the Darnell laboratory has led the way in the global analysis of RNA binding protein ... technical innovations have facilitated the investigation of alternative splicing at a global scale. Splice-sensitive microarray platforms and deep sequencing allow quantitative profiling of very large ... Misquitta C, Zhang W, Saltzman AL,Mohammad N, Babak T, Siu H, Hughes TR, MorrisQD et al. (2004) Revealing global regulatory features of mammalian alternative splicing using a quantitativemicroarray...
- 11
- 544
- 0
Báo cáo khoa học: 15 N-Labelled proteins by cell-free protein synthesis Strategies for high-throughput NMR studies of proteins and protein–ligand complexes doc
... Combinatorial labelling minimizes thenumber of samples that need to be prepared and ana-lyzed in order to obtain the same information as thatobtained from a much larger set of selectively labelledsamples.Different ... coli. In particular, interconver-sion between Ala and Glu, Glu and Asp, and Glu and Gln is efficient in wheat germ extract but can effect-ively be suppressed by inhibitors of transaminases and glutamine ... vivo had to exclude gluta-mine, glutamate, asparagine and aspartate from thelabelling scheme because of excessive cross-labelling[17]. In order to avoid the use of expensive [15N]-amino acids,...
- 6
- 461
- 0
Báo cáo khoa học: The signature amidase from Sulfolobus solfataricus belongs to the CX3C subgroup of enzymes cleaving both amides and nitriles Ser195 and Cys145 are predicted to be the active site nucleophiles pot
... water-bondedintermediate. In contrast, serine and thiol protease and amidase are confined to interacting with planar sub-strates and tetrahedral intermediates [2].Our comparative model suggests that the two cata-lytic ... recombinant SsAH-WT remainsactive at 70 °C for about 6 days and has a half-life of 5 h at 95 °C (data not shown).We found that SsAH-WT is able to convert bothamides and nitriles, and in particular ... 177 A AO55930 PSEDATVVKRLLAAGATVVGKSVCEDLCFSGASFTSASGAVKNPWDLARNAGGSSSGSAV 177 ZP_00124054 PSEDATVVKRLLAAGATVIGKSVCEDLCFSGASFTSATGAVKNPWDLTRNAGGSSSGSAV 177 BAC99079 PSRDATVVTRLLAAGATVAGKAVCEDLCFSGSSFTPASGPVRNPWDPQREAGGSSGGSAA...
- 9
- 478
- 0
Từ khóa: Nghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thốngchuyên đề điện xoay chiều theo dạngNghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THzGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANPhát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninhNghiên cứu, xây dựng phần mềm smartscan và ứng dụng trong bảo vệ mạng máy tính chuyên dùngNghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chếTìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tinTăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)Tranh tụng tại phiên tòa hình sự sơ thẩm theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn xét xử của các Tòa án quân sự Quân khu (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtNguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtBÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIĐổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namQUẢN LÝ VÀ TÁI CHẾ NHỰA Ở HOA KỲ