báo cáo khoa học: " Identification and analysis of common bean (Phaseolus vulgaris L ) transcriptomes by massively parallel pyrosequencing" doc
báo cáo khoa học: " Identification and analysis of common bean (Phaseolus vulgaris L.) transcriptomes by massively parallel pyrosequencing" doc
... Kalavacharla et al.: Identification and analysis of
common bean (Phaseolus vulgaris L. ) transcriptomes by massively
parallel pyrosequencing. BMC Plant Biology 2011 11:135.
Kalavacharla et al. BMC Plant ... 18
RESEARCH ARTICLE Open Access
Identification and analysis of common bean
(Phaseolus vulgaris L. ) transcriptomes by
massively...
báo cáo khoa học: "Identification and analysis of phosphorylation status of proteins in dormant terminal buds of poplar" pptx
... GAPC isoforms (821843, 575307 and 72899 8) and
three PEPC isoforms (552645, 745223, and 72831 5) were
phosphorylated (Additional file 13 and Additional file 3).
Liu et al. BMC Plant Biology 2011, ... Proteins whose ortholog(s) are phosphorylated 110
5) Equivalent site(s) are phosphorylated in ortholog(s) 62
6) Other site(s) are phosphorylated in ortholog(s) 48
Liu et...
Báo cáo khoa học: " Identification and prevalence of Ehrlichia chaffeensis infection in Haemaphysalis longicornis ticks from Korea by PCR, sequencing and phylogenetic analysis based on 16S rRNA gene" docx
... generally characterized by clinical signs
of fever (100 %), rash (67 %), myalgia (58 %), vomiting,
diarrhea, and headache (25 %) [2,12,26]. Diagnosis of HME
is still largely based on the combined evaluation ... identical or similar to the Arkansas
(AF41676 4), the Sapulpa (U6047 6) and the 91HE17
(U2350 3) strains, all of these originate from the USA (Table
2)....
báo cáo khoa học: " Identification and characterization of wheat long non-protein coding RNAs responsive to powdery mildew infection and heat stress by using microarray analysis and SBS sequencing" ppsx
... figure
displays all the possible ORFs in the full length cDNA of TalnRNA21, and
none of them are longer than 80aa.
Additional file 9: The short possible ORFs in TahlnRNA37. The figure
displays all the ... (Additional file
1), and all of them had similar expression pattern in
microarray analysis and SBS sequencing. Most of these
long npcRNAs produced more than one small RNA...
Báo cáo khoa học: "Synthesis and analysis of biomass and net primary productivity in Chinese forests" docx
... personal communication).
The types of field measurements of biomass and NPP
that are available for biomes worldwide depend largely
on plant growthform and life cycle length. NPP is gener-
ally calculated ... area of a needle leaf, a and b are
the width of a leaf at top and bottom, respectively, and L
is the length of a needle leaf.
The specific leaf area of each tree s...
Báo cáo y học: "Identification and analysis of unitary pseudogenes: historic and contemporary gene losses in humans and other primates" docx
... S4 in Additional file 1 for
allele frequency information). Each of the nonsense
alleles should effec tively pseudogenize the gene, as all
three SNPs are located in the early part of the coding
sequences. ... equilibrium
for the two alleles of each SNP in each population and
all populations combined. Our statistical analysis shows
that, in the meta-population, the two alleles, T/G,...
báo cáo khoa học: " Characterization and analysis of the cotton cyclopropane fatty acid synthase family and their contribution to cyclopropane fatty acid synthesis" pot
... the pyrolytic alkylation of acidic
compounds. Anal Lett 1982, 15:841-850.
35. Christie WW, (Ed .): Lipid Analyalysis: Isolation, Separation, Identification
and Structural Analysis of Lipids. Bridgwater, ... first aligned by CLUSTALW
version 2.0.12 (Additional file 1) [28] with default para-
meters (http://www.ebi.ac.uk/Tools/clustalw /), and
imported into the Molecular Ev...
báo cáo khoa học: " Identification and characterization of the Nonrace specific Disease Resistance 1 (NDR1) orthologous protein in coffee" doc
... FPLRSSFPISVLMNLLVFFAIR
AtNHL38 234 LPLRSSFPIFVLMNLLVFFAIR
AtNHL16 197 QRLTFFQVCFSIICVLMNWLIFLAIR
CaNDR1a 195 VRCPGLVVISIALYFLVLLL
CaNDR1b 195 VRCPGLVVISIALYFLVLLL
*
Figure 2 NDR1, N HL16 and NHL3 8 are the closest Arabidopsis ... MTKIDPEEELGRKCCTCFFKFIFTTRLGALILWLS-LRAKKPKCSIQNFYIPALSKNL
AtNHL16 1 -MDRDDAWEWFVTIVGSLMTLLYVSFLLALCLWLSTLVHHIPRCSIHYFYIPALNKSL
CaNDR1a 1 MSDPSSSAGGCCRCCCSFILT...
báo cáo khoa học: " Identification and characterisation of seed storage protein transcripts from Lupinus angustifolius" docx
... sequences and L. angustifolius (A) 11S globulin (a conglutin),
(B) 7S globulin (b conglutin), (C) basic 7S (g conglutin) and (D) 2S sulphur-rich albumin (δ conglutin) deduced amino acid sequences. L.
angustifolius ... white
lupin (La 1) and peanut than to NLL ALPHA2 or
ALPHA3 (Figure 3A). In general, 7S globuli n sequences
showed greatest identity within species (Figure 3B). For
e...
báo cáo khoa học: " Identification and characterization of flowering genes in kiwifruit: sequence conservation and role in kiwifruit flower development" ppt
... 15
$3
$UDELGRSVLV
&$/$UDELGRSVLV
648$$QWLUUKLQXP
$3OLNH9LWLV
0W3,00HGLFDJR
3,03LVXP
0G$30DOXV
)8 /$UDELGRSVLV
)8 /OLNH$FWLQLGLD
)8 /OLNH9LWLV
($3(XFDO\SWXV
)8 /$FWLQLGLD
3)* 3HWXQLD
70/\FRSHUVLFRQ
0$'61LFRWLDQD
0$'61LFRWLDQD
6(3$FWLQLGLD
)% 33HWXQLD
6(3$UDELGRSVLV
6(3$UDELGRSVLV
6(3$UDELGRSVLV
6(3$FWLQLGLD
' ()+ ...
Từ khóa:
- báo cáo khoa học mẫu
- báo cáo khoa học y học
- báo cáo khoa học sinh học
- báo cáo khoa học nông nghiệp
- báo cáo khoa học lâm nghiệp
- báo cáo khoa học thủy sản
- Báo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018
- chuyên đề điện xoay chiều theo dạng
- Nghiên cứu tổ hợp chất chỉ điểm sinh học vWF, VCAM 1, MCP 1, d dimer trong chẩn đoán và tiên lượng nhồi máu não cấp
- Nghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt nam
- Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit
- Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit
- Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit
- Quản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninh
- Phát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninh
- Tìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tin
- Thơ nôm tứ tuyệt trào phúng hồ xuân hương
- Thiết kế và chế tạo mô hình biến tần (inverter) cho máy điều hòa không khí
- Sở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIX
- Quản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)
- Tăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)
- Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vật
- Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vật
- Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật
- Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật
- Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật