0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Báo cáo khoa học >

Báo cáo y học: "Loss of function mutation in toll-like receptor-4 does not offer protection against obesity and insulin resistance induced by a diet high in trans fat in mice" docx

Báo cáo y học:

Báo cáo y học: " Loss of function mutation in toll-like receptor-4 does not offer protection against obesity and insulin resistance induced by a diet high in trans fat in miceg" pdf

... protection against obesity and insulin resistance induced by a diet high in trans fat in mice. Journal of Inflammation 2011 8:2.Submit your next manuscript to BioMed Central and take full advantage of: ... signaling by trasducing pro-duction of proinflammatory markers in macrophages,adipocytes, and liver leading to insulin resistance. Insu-lin resistance is a main pathological abnormality asso-ciated ... saturated fat -induced TLR4 signaling pathway is a likely mechan-ism linking dietary fat with inflammation and insulin resistance associated with obesity and type-2 diabetes[9,10,15-21]. Conversely,...
  • 7
  • 272
  • 0
Báo cáo y học:

Báo cáo y học: "Loss of function mutation in toll-like receptor-4 does not offer protection against obesity and insulin resistance induced by a diet high in trans fat in mice" docx

... protection against obesity and insulin resistance induced by a diet high in trans fat in mice. Journal of Inflammation 2011 8:2.Submit your next manuscript to BioMed Central and take full advantage of: ... signaling by trasducing pro-duction of proinflammatory markers in macrophages,adipocytes, and liver leading to insulin resistance. Insu-lin resistance is a main pathological abnormality asso-ciated ... saturated fat -induced TLR4 signaling pathway is a likely mechan-ism linking dietary fat with inflammation and insulin resistance associated with obesity and type-2 diabetes[9,10,15-21]. Conversely,...
  • 7
  • 238
  • 0
Báo cáo Y học: Loss-of-function variants of the human melanocortin-1 receptor gene in melanoma cells define structural determinants of receptor function doc

Báo cáo Y học: Loss-of-function variants of the human melanocortin-1 receptor gene in melanoma cells define structural determinants of receptor function doc

... loss of binding affinity observed in radioligand binding assays (Fig. 6B). This reduced affinityfor NDP-MSH of the Glu94Arg variant was evident by a Fig. 6. Functional analysis of an artificial MC1R ... FEBS 2002antibody. Comparable loading and transfer were ascer-tained by cutting the lower portion of the membranebefore blocking and staining for total protein with AmidoBlack.RESULTS AND DISCUSSIONSeven ... not the result of a PCR artifact was ascertained by repeated amplification and sequencing reactions, and by the observation that the sameallele was found in the IC8 and T1C3 cell lines, which bothcome...
  • 9
  • 356
  • 0
Báo cáo y học:

Báo cáo y học: "Loss of genes implicated in gastric function during platypus evolution" docx

... provided platypus and echidna sam-ples. All authors read and approved the final manuscript.Additional data filesThe following additional data files are available. Additionaldata file 1 is a figure ... bp)GACTCTCTGAATGGGAAGTCATTTTGCATCACCT LINE2 SINE LINE2 TCCAGTGGATTATAGGGAATAACTTCACTGGGCAGTTTTATTCCATCTTTGATCATGGGAATAACTTTGTTGGAATTGC CCCAATTATTCCTTAG SINEDSLNGKSFCWIIGNNFTGQFYSIFDHGNNFVGIAPIIP*exon 9 (3’-end)exon ... 5'-GGTTTT-GCCTTTCAGG GAAGG) and GAPDH (5'-AAGGCTGT-GGGCAAGGTCAT and 5'-CTGTTGAAGTCACAGGAGAC).AbbreviationsBAC, bacterial artificial chromosome; EST, expressedsequence tag; LINE, long interspersed...
  • 11
  • 283
  • 0
báo cáo khoa học:

báo cáo khoa học: "Loss-of-function mutations affecting a specific Glycine max R2R3 MYB transcription factor result in brown hilum and brown seed coats" docx

... coat/hilum phenotype in soybean.BackgroundDomestication of SoybeanSoybean [Glycine max (L.) Merr.] is a remarkable plant,producing both high quality oil and protein and is one of the primary ... anthocyanins to seed coats. Thoug hhypothetical, this may represent a viable, alternatemeans to visually select for transgene integration and/ or a visual means to assist in containment of transgeniclines.ConclusionsWe ... F3H:Flavanone 3-Hydroxylase; F3’5’H: Flavonoid 5’ 3’ Hydroxylase; F3’H: Flavonoid3’ Hydroxylase; LAR: Leucoanthocyanidin Reductase; PAL: PhenylalanineAmmonia-Lyase; PI: Plant Introduction line;...
  • 12
  • 296
  • 0
Báo cáo y học:

Báo cáo y học: "Role of γδ T cells in protecting normal airway function" docx

... methacholine (MCh), namelyincreased lung resistance (measured plethysmographi-cally) and decreased dynamic compliance, a correlate of the ability of the airways to recoil after the release of airpressure ... (toE.W.G.).ReferencesArticles of particular interest have been highlighted as:• of special interest•• of outstanding interest1. Saito H, Kranz DM, Takagaki Y, Hayday A, Eisen H, Tonegawa S:Complete primary ... by 8h of recovery) was used to cause damagepredominantly to ciliated epithelial cells in the anterior nasalcavity, trachea and central acinus. This acute injury alsoresulted in substantial epithelial...
  • 8
  • 302
  • 0
Báo cáo y học:

Báo cáo y học: " Predictors of hepatic steatosis in HBeAg-negative chronic hepatitis B patients and their diagnostic values in hepatic fibrosis"

... glucose (FBG), insulin, triglyceride (TG), cholesterol (CHOL), ALT, aspartate amino-transferase (AST), γ-glutamyltransferase (GGT), alka-line phosphatases (ALP), albumin (Alb) and globulin (Glb) ... recruited into this study. The levels of fasting blood glucose (FBG), fasting insulin (FINS), triglyceride (TG), cholesterol (CHOL), alanine amino-transferase (ALT), aspartate aminotransferase (AST), ... more than 6 portal areas. Specimens were fixed in buffered formalin, embedded in paraffin, and stained with hematoxylin-eosin-safran and Masson's trichrome. Hepatic steatosis, stage of fibrosis...
  • 6
  • 606
  • 0
Báo cáo y học:

Báo cáo y học: "Management of HBV Infection in Liver Transplantation Patients"

... Transplantation at Cedars-Sinai Medical Center. His basic and translational research interests involve the immunological and inflammatory mechanisms of pathogenesis in alloimmune and autoimmune ... contributing to the efficacy of combination LAM and HBIG remain poorly defined. Postulated mechanisms include the synergy of: 1) LAM reducing HBV replication and altering synthesis of HBsAg necessary ... survival. Since liver allocation priority increases with liver disease severity in the U.S .A. , LAM therapy does not jeopardize access to a donated organ. Adefovir Monotherapy ADV is active against...
  • 9
  • 671
  • 0
Báo cáo Y học: Inhibition of hyaluronan synthesis in Streptococcus equi FM100 by 4-methylumbelliferone doc

Báo cáo Y học: Inhibition of hyaluronan synthesis in Streptococcus equi FM100 by 4-methylumbelliferone doc

... containing fatty acidswith a particular chain length and unsaturation pattern, and that the MU treatment of cells decreases the availability of these favorable CL species. Additionally, the interaction ... Shinomura, T., Hamaguchi, M., Yoshida, Y. ,Ohnuki, Y. , Miyauchi, S., Spicer, A. P., McDonald, J .A. &Kimata, K. (1999) Three isoforms of mammalian hyaluronansynthases have distinct enzymatic ... reconstituting HA synthesisactivity at 2 mMMU can be explained by the decreased level of HAS protein noted above. CL addition did not cause a significant increase in HAS activity in the extracts...
  • 10
  • 541
  • 0
Báo cáo Y học: Role of tyrosine 238 in the active site of Rhodotorula gracilis D-amino acid oxidase A site-directed mutagenesis study docx

Báo cáo Y học: Role of tyrosine 238 in the active site of Rhodotorula gracilis D-amino acid oxidase A site-directed mutagenesis study docx

... flavin position is also marginallyaltered by the substitution of Y2 38 (Table 2).Steady-state and rapid reaction kinetics withD-alanineThe ability of the Y2 38 mutants to catalyseD-alanine/oxygen ... half-reaction of Y2 38 mutants withD-alaninewas measured by mixing anaerobically a solution of eachmutant enzyme with solutions containing varying concen-trations of D-alanine, such that ... mutagenesisexperiments, but only by replacing a phenylalanine (a nondisruptive mutation) . In the case of RgDAAO we alsochanged the spatial arrangement in the active site by introducing a serine.In...
  • 10
  • 496
  • 0

Xem thêm

Từ khóa: Báo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018Báo cáo quy trình mua hàng CT CP Công Nghệ NPVNghiên cứu tổ hợp chất chỉ điểm sinh học vWF, VCAM 1, MCP 1, d dimer trong chẩn đoán và tiên lượng nhồi máu não cấpNghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt namBiện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANNghiên cứu, xây dựng phần mềm smartscan và ứng dụng trong bảo vệ mạng máy tính chuyên dùngNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngNghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000Chuong 2 nhận dạng rui roKiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)BT Tieng anh 6 UNIT 2Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)BÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIChiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015Đổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namHIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀM