0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Báo cáo khoa học >

Báo cáo khoa học: "Management of gastrointestinal stromal tumours in the Imatinib era: a surgeon''''''''s perspective" pps

Báo cáo khoa học:

Báo cáo khoa học: "Management of gastrointestinal stromal tumours in the Imatinib era: a surgeon''''s perspective" pps

... adjuvant Imatinib while waiting for the final outcomes of ongoing trials.• Laparoscopic surgery The change in nomenclature from leiomyosarcoma toGIST and the advent of Imatinib has changed the generalperception ... Nasierowska-Guttmejer A, Krawczyk M, Ruka W: Surgi-cal treatment of patients with initially inoperable and/ormetastatic gastrointestinal stromal tumors (GIST) duringtherapy with imatinib mesylate. ... CentralPage 1 of 4(page number not for citation purposes)World Journal of Surgical OncologyOpen AccessResearchManagement of gastrointestinal stromal tumours in the Imatinib era: a surgeon's...
  • 4
  • 345
  • 0
Tài liệu Báo cáo khoa học: Role of K22 and R120 in the covalent binding of the antibiotic fosfomycin and the substrate-induced conformational change in UDP-N-acetylglucosamine enol pyruvyl transferase docx

Tài liệu Báo cáo khoa học: Role of K22 and R120 in the covalent binding of the antibiotic fosfomycin and the substrate-induced conformational change in UDP-N-acetylglucosamine enol pyruvyl transferase docx

... mutant protein is not due to a lack of adductformation, but rather indicates that the binding process isnot associated with a measurable net heat change. The finding that binding of UDPNAG to the ... form the covalent adduct. On the other hand, the K22V mutant protein requires the presence of UDPNAGfor the formation of the adduct indicating that UDPNAGplays a crucial role in the organization ... put on analysis of the heatcapacity decrement as this parameter is a sensitive indicator of both the changes in hydration and the conformationalchanges involved in protein–ligand interactions...
  • 9
  • 707
  • 0
Báo cáo khoa học: Role of DptE and DptF in the lipidation reaction of daptomycin ppt

Báo cáo khoa học: Role of DptE and DptF in the lipidation reaction of daptomycin ppt

... polymerase (Finnzymes) and the syntheticoligonucleotide primers 5¢-AAAAAAGAATTCATGTCAGACCTCAGCACCGC-3¢ and 5¢-AAAAAAAGCTTTCAGGCGGAACGCAGCTC-3¢ (EcoRI and HindIII restric-tion sites are underlined). ... Hisanaga Y, Ago H, Nakagawa N, Hamada K, Ida K,Yamamoto M, Hori T, Arii Y, Sugahara M, KuramitsuS et al. (2004) Structural basis of the substrate-specifictwo-step catalysis of long chain fatty ... by a lineargradient down to 5% buffer A in 2 min. 5% buffer A washeld for an additional 2 min and followed by a lineargradient up to 95% buffer A in 6 min.Determination of the acyl adenylate...
  • 12
  • 674
  • 0
Báo cáo khoa học: Deamidation of labile asparagine residues in the autoregulatory sequence of human phenylalanine hydroxylase potx

Báo cáo khoa học: Deamidation of labile asparagine residues in the autoregulatory sequence of human phenylalanine hydroxylase potx

... countingand analysis of the data by the PEAKFITsoftware program. Each datapoint represents the average value obtained in three separate experi-ments, and the two lines were calculated by linear ... experimentsdemonstrating that both deamidation of Asn32 and muta-tion of Asn32fiAspareaccompaniedbya 20% increase in the initial rate of phosphorylation at Ser16 by PKA [39].Thus, it appears that phosphorylation ... hPAH as in rPAH, as its nearest neighbouramino acids and the loop structure are the same in the twoproteins. The perturbation of the overall conformation of the loopstructure as a result of...
  • 10
  • 450
  • 0
Báo cáo khoa học: Cooperation of two carotene desaturases in the production of lycopene in Myxococcus xanthus pot

Báo cáo khoa học: Cooperation of two carotene desaturases in the production of lycopene in Myxococcus xanthus pot

... complementary oligonucleotides,Part-5 (5¢-CTAGATTGACAGGCCGGAATATTTCCCTATAATGCGCAT-3¢) and Part-6 (5¢-CGATGCGCATTATAGGGAAATATTCCGGCCTGTCAAT-3¢), which con-tain, like the Part-1-2 promoter, the E. ... promoterwas generated by hybridization of two complementary oli-gonucleotides, Part-1 (5¢-AGCTTGACAGGCCGGAATATTTCCCTATAATGCGCTGCA-3¢) and Part-2 (5¢-GCGCATTATAGGGAAATATTCCGGCCTGTCA-3¢), whichcontain ... blakesleeanus, as described in detail in Martinez–Laborda et al. [11]. The separated caroteneswere collected, concentrated and resuspended in hexanefor their analysis. All manipulations of carotenoids...
  • 9
  • 391
  • 1
Báo cáo khóa học: Characterization of novel structural features in the lipopolysaccharide of nondisease associated nontypeable Haemophilus influenzae pptx

Báo cáo khóa học: Characterization of novel structural features in the lipopolysaccharide of nondisease associated nontypeable Haemophilus influenzae pptx

... themembers ofthe Finnish Otitis MediaStudy Group at the National Public Health Institute in Finland for the provision of NTHi strains from the nasopharynx, obtained as part of the Finnish Otitis Media ... strains 11 and 16 are isolatesfrom the nasopharynx of infants of 21 and 20 months of age, respectively, and are part of a series of studies aimed atevaluating conjugate pneumococcal vaccines conducted ... (ESI-MSn). The relative proportions of the various alditol acetates and partially methylatedalditol acetates obtained in sugar- and methylation-analysesare reported as the detector responses of the...
  • 13
  • 411
  • 0
Báo cáo khoa học: Contribution of exofacial thiol groups in the reducing activity of Lactococcus lactis docx

Báo cáo khoa học: Contribution of exofacial thiol groups in the reducing activity of Lactococcus lactis docx

... 803–806.14 Bagramyan K, Mnatsakanyan N, Poladian A, Vassilian A & Trchounian A (2002) The roles of hydrogenases 3and 4, and the F0F1-ATPase, in H2 production byEscherichia coli at alkaline and acidic ... 3,3¢-diaminobenzidine Color Develop-ment Solution (Bio-Rad) and hydrogen peroxide.Statistical analysisData were analysed using the statistical analysis softwareMinitab13Ò(Minitab Inc., State ... cytoplasmicmembrane [30]. The identification of proteins locatedon the extracellular surface and involved in the decrease in Ehwould be of interest for increasing ourunderstanding of the mechanisms involved...
  • 9
  • 320
  • 0
Báo cáo khoa học: Role of calcium phosphate nanoclusters in the control of calcification pot

Báo cáo khoa học: Role of calcium phosphate nanoclusters in the control of calcification pot

... urease tocatalyse the reaction, producing the strong base ammoniaand weak carbonic acid. The amount of urea determines the final pH (typically 6–8) and the amount of enzyme canvary the time taken ... rheomorphicproteins – interpretation of primary and secondary struc-tures of the alpha-S1-caseins, beta-caseins and kappa-caseins. J Chem Soc Faraday Trans 89, 2683–2692.36 Kawasaki K & Weiss ... scattering sphericalparticles formed from an initial state dominated by the scattering of a statistical polymer but, after about2 days, the scattering profile showed hardly any fur-ther change,...
  • 16
  • 343
  • 0
Báo cáo khoa học: Analysis of ancient sequence motifs in the H+-PPase family doc

Báo cáo khoa học: Analysis of ancient sequence motifs in the H+-PPase family doc

... discrepancybetween AVAVA and ADADA.Three of the sequences found had long segmentsconsisting of repetitious patterns containing two of the four early amino acid residues A, G, D and V. The residues A and D, ... underlined in the following sequence: LGGGIFTKCADVGADLVGKVEAGIPEDDPRNPAVIADNVGDNVGDCAGMAADLFETY. In what apparently is a pyrophosphate-bindingregion and an essential part of the active site for the phosphorylation ... amino acid residues Gly, Ala, Valand Asp, compatible with an ancient origin of the inorganic pyrophospha-tases. The nonapeptide patterns have charged amino acid residues at posi-tions 1, 5 and...
  • 11
  • 369
  • 0
Báo cáo khoa học: Presence of membrane ecdysone receptor in the anterior silk gland of the silkworm Bombyx mori pdf

Báo cáo khoa học: Presence of membrane ecdysone receptor in the anterior silk gland of the silkworm Bombyx mori pdf

... activities,and the activities were expressed as a percentage of the totalactivity in all three phases.Data analysisExperimental data were analysed usingORIGINsoftware(OriginLab, Northampton, MA, ... theirvaluable comments for establishing the binding assay. We are alsothankful to Dr Haruhiko Fujiwara of the University of Tokyo for the gift of anti-EcR -A serum and Dr Yoshiaki Nakagawa of ... fractions withincreasing concentrations of [3H]PonA, then subjecting the binding data to Scatchard analysis (Fig. 4). The analysisshowed the presence of a single high-affinity binding site in each...
  • 9
  • 315
  • 0

Xem thêm

Từ khóa: Báo cáo quy trình mua hàng CT CP Công Nghệ NPVNghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THzNghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt namGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitPhát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninhTrả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Phát triển du lịch bền vững trên cơ sở bảo vệ môi trường tự nhiên vịnh hạ longNghiên cứu, xây dựng phần mềm smartscan và ứng dụng trong bảo vệ mạng máy tính chuyên dùngNghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chếNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngTìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tinKiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)Quản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)BT Tieng anh 6 UNIT 2Tăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtNguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)BÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIĐổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt nam