0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Báo cáo khoa học >

Báo cáo y học: " Biomarkers for systemic lupus erythematosus: has the right time finally arrived" pdf

Báo cáo Y học: Evidence for general stabilization of mRNAs in response to UV light pdf

Báo cáo Y học: Evidence for general stabilization of mRNAs in response to UV light pdf

... stabilityof mRNAs expressed using the tet-off system which allows the termination of only the synthesis of the mRNA understudy. This enabled us to also investigate transcripts withcomparatively long ... the group ofsamples. The next day transcription from the tetracycline-regulatable promoter was stopped by addition ofdoxycycline (3 lgÆmL)1). At the indicated times thereaf-ter, total RNA ... most other mRNAs, the histone transcripts are not polyadenylated [32]. Thereforethis result indicates that the poly(A) tail is also dispensableFig. 5. UV light but not activation of the p38/MK2...
  • 10
  • 452
  • 0
Báo cáo y học:

Báo cáo y học: "Prohormones for prediction of adverse medical outcome in community-acquired pneumonia and lower respiratory tract infections"

... prognosticaccuracy. Both risk scores were validated for the predic-tion of mortality only. Their ability to predict otherimportant adverse disease outcomes including the need for ICU admission ... relevance for public health,both for primary and hospital care. The ultimate clinicalutility of a biomarker is defined by the degree it improvesclinical decision making and adds timely informationbeyond ... technology assay (PCTKryptor®, B.R.A.H.M.S. AG, Hennigsdorf, Germany). The assay has a detection limit of 0.02 μg/L and functionalassay sensitivity of 0.06 μg/L.Statistical analysisDevelopment...
  • 14
  • 497
  • 0
Báo cáo y học:

Báo cáo y học: " Rationale for one stage exchange of infected hip replacement using uncemented implants and antibiotic impregnated bone graft"

... concentrations provided by systemic anti-biotic therapy and commonly available carrier sys-tems are insufficient in eliminating biofilm bacteria new ways of antibiotic delivery are required. The cri-teria ... levels around 32x the MIC of planktonic forms the station-ary phase pathogens are reduced by 2 logs within 24h 42. Vancomycin shows the least cytotoxic effect of all commonly used antibiotics ... culturing the sonication fluid is likely to raise sensitivity of cultures significantly. Especially in patients having received antimicrobial therapy within 14 days before culture the sensitivities...
  • 6
  • 466
  • 0
Báo cáo y học:

Báo cáo y học: "Foundation for the Community Control of Hereditary Diseases, Budapest, Hungary"

... camptodactyly, partial syndactyly between toes 2 and 3, hydrocele, umbilical hernia, sacral dimple, etc) without serious medical or cosmetic consequences are excluded from the category of congenital ... prevalence in the past. However, recently the different methods of prenatal diagnoses have been used widely for the detection of fetal defects and pregnancies are frequently terminated if the fetus ... abnormalities evaluated, the period of study (only at birth or in early neonatal period or prenatal or the whole infant period are included), the completeness of ascertainment, the diagnostic skill...
  • 2
  • 626
  • 0
Báo cáo Y học: Barley a-amylase Met53 situated at the high-affinity subsite )2 belongs to a substrate binding motif in the bfia loop 2 of the catalytic (b/a)8-barrel and is critical for activity and substrate specificity pot

Báo cáo Y học: Barley a-amylase Met53 situated at the high-affinity subsite )2 belongs to a substrate binding motif in the bfia loop 2 of the catalytic (b/a)8-barrel and is critical for activity and substrate specificity pot

... licheniformis 78–95 TSQA DVGYGAYDLYDLGE P06278Bacterium Paenibacillus polymyxa 812–830 KSE YAYHGYHTYDFYAVDG P21543Bacterium Escherichia coli 255–285 IHGWVGGGTKGDFPHYAYHGYYTQDWTNLDA P25718G4-forming ... Otherbinding residues (W9AMY2, H92AMY2, T94AMY2, A95AMY2, Y1 30AMY2, A145AMY2, F180AMY2, K182AMY2, W206AMY2,S208AMY2, Y2 11AMY2, H288AMY2, Q294AMY2, M296AMY2andQ35TAA, H122TAA, ... Aspergillus oryzae 69–92 LPQTTAYG DAYHGYWQQDIYSLNE P10529Yeast Saccharomycopsis fibuligera 96–119IPDNTAYG YAYHGYWMKNIYKINE P21567Bacterium Bacillus stearothermophilus 111–135 LDTLAGTDN TGYHGYWTRDFKQIEE...
  • 14
  • 557
  • 0
Báo cáo y học:

Báo cáo y học: "Fishing for Allergens: Bloodworm-Induced Asthma" doc

... breath and skin rash whenfeeding the fish. The patient keeps no pets athome, and although there is no personal history ofatopy, her father has hay fever. The physical exam-ination was unremarkable ... workplace, a research laboratory thatstudies fish biology. On a recent holiday, hersymptoms completely resolved, but they recurredwithin a week of her returning to work. The patientlater noted shortness ... in the workplace. Salbutamol, budesonide,and mometasone nasal spray was prescribed. The patient was also asked to keep a peak flow diaryand to bring a sample of the fish food for allergytesting...
  • 2
  • 247
  • 0
Báo cáo y học:

Báo cáo y học: "Validation and test-retest reliability of the Royal Free Interview for Spiritual and Religious Beliefs when adapted to a Greek population" doc

... from the community on the basisof their availability. They received a brief explanation of the purpose and the aim of the study, and those whoagreed to participate were asked to sign an informed ... experience. For these four persons, the mean effect of this experienceon their lives was moderate (4.69 ± 2.9). The majority ofpersons participating in our study answered that theyprayed by themselves ... that they underwent anintense experience at a time when they almost died, butwere eventually revived. Four other persons were uncer-tain as to whether or not they had had such an experience.For...
  • 8
  • 450
  • 0
Báo cáo y học:

Báo cáo y học: "Postictal psychosis: presymptomatic risk factors and the need for further investigation of genetics and pharmacotherapy" doc

... temporalhyperperfusion as assessed by SPECT in postictal psycho-sis [19], and they thereby argue against the Todd's paraly-sis hypothesis which might predict hypoperfusion. The temporal ... I. Symmetry and convergence of the corticocorticalconnections of the left and the right principal sulcus (PS) and the left and the right supplementary motor area (SMA) in the rhesus monkey. Cereb ... psychosis may not resolveentirely between episodes [3]. Family history of mood dis-order (as in our case) has been implicated [13]. Familyhistory of psychosis has been noted in one study [14].However,...
  • 6
  • 514
  • 0
Báo cáo y học:

Báo cáo y học: "Fluvoxamine for aripiprazole-associated akathisia in patients with schizophrenia: a potential role of sigma-1 receptors" ppt

... with atypical antipsychotic drugs. Although understanding of the pathophysiology of akathisiaremains limited, it seems that a complex interplay of several neurotransmitter systems might play a ... activity as a molecular chaperone,activity that can be activated/inactivated by syntheticcompounds that bind to sigma-1 receptors [9,10].Furthermore, sigma-1 receptors play important roles in the ... Su TP: The pharmacology of sigma-1 receptors. Pharmacol Ther2009, 124:195-206.8. Ishikawa M, Hashimoto K: The role of sigma-1 receptors in the pathophysiology of neuropsychiatric diseases. J...
  • 3
  • 403
  • 0
Báo cáo y học:

Báo cáo y học: "Fluvoxamine for blonanserin-associated akathisia in patients with schizophrenia: report of five cases." pps

... beperformed to clarify the role of sigma-1 receptors in the efficacy of fluvoxamine for akathisia.Furuse and Hashimoto Annals of General Psychiatry 2010, 9:17http://www.annals-general-psychiatry.com/content/9/1/17Open ... mg) for the last 4 years, but he had a ten-dency to stop the medication due to appetite and bodyweight. He was admitted to the hospital due to delusionsand hallucinations at his older brother's ... (DSM-IV) criteria for schizophrenia. Onset ofschizophrenia occurred in his early twenties. The typicalantipsychotic drug haloperidol was administered for some time. After he stopped the medication...
  • 4
  • 426
  • 0

Xem thêm

Từ khóa: Báo cáo quy trình mua hàng CT CP Công Nghệ NPVNghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THzBiện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANQuản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninhPhát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninhPhát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu, xây dựng phần mềm smartscan và ứng dụng trong bảo vệ mạng máy tính chuyên dùngNghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chếTìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tinChuong 2 nhận dạng rui roKiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)Quản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtchuong 1 tong quan quan tri rui roGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtBÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIĐổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt nam