Báo cáo khoa học: " A novel b-glucan produced by Paenibacillus polymyxa JB115 induces nitric oxide production in RAW264.7 macrophages" docx
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... Tmvalue of each protein at neutralpH. a Data from this study.bData from Griffin et al. [32].cData from Yano et al. [4].T. Mandai et al. Thermostable electron transport system FEBS Journal ... DNA poly-merase was purchased from Toyobo (Osaka, Japan). Emul-gen 911 was a gift from Kao Chemical (Tokyo, Japan).NADPH, NADH and NADP+were purchased from Oriental Yeast (Tokyo, Japan). a- Cyano-4-hydroxycinnamicacid...
- 14
- 617
- 0
Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx
... of wild-type occludin (OccWT) and variant occludin in apoptosis and invasion, as determined by assay, werevealed that exon 9 played a major role in the induc-tion of mitochondria-mediated apoptosis and ... (sense) and 5Â-GAAAAAACGCGATCCTACTT-3Â (antisense). Primersfor unmethylated DNA were: 5Â-GAAGTAGGTGGAGTATTGAAT-3Â (sense) and 5Â-CAAAAAAACACAATCCTACTT-3Â (antisense).Caspase 3 activityCells subjected ... apoptosis and invasion FEBS Journal 275 (2008) 31453156 ê 2008 The Authors Journal compilation ê 2008 FEBS 3155 A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and...
- 12
- 613
- 0
Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt
... from the salivary gland of Octopus vulgaris oct-TK-I Lys–Pro–Pro–Ser–Ser–Ser–Glu–Phe–Ile–Gly–Leu–Met–NH2oct-TK-II Lys–Pro–Pro–Ser–Ser–Ser–Glu–Phe–Val–Gly–Leu–Met–NH2Substance P and SP-(Arg11)Substance ... tachykinins: a review. Zool Sci 5,53 3–5 49.7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy-ama M, Minakata H, Chiba T, Metoki H, Satou Y &Satoh N (2004) Tachykinin and tachykinin receptor of an ascidian, ... (Octopus vulgaris) .Biochem J 387, 8 5–9 1.25 Kanda A, Takahashi T, Satake H & Minakata H (2006)Molecular and functional characterization of a novel gonadotropin-releasing-hormone receptor isolated...
- 11
- 595
- 0
Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt
... NADPHwere also obtained from Sigma. Sephadex G-25 was pur-chased from Pharmacia (Uppsala, Sweden). All the othermaterials were of analytical grade and obtained fromBeijing Chemical Plant (Beijing, ... experi-ment carried out without the mimic, ascorbate, and ferroussulfate was known as the control group.Biological analysis of mimics againstmitochondrial damageMitochondrial swelling was assayed as ... swelling and a decrease in mitochondria integrity.TBARS content in ferrous sulfate ⁄ ascorbate-treatedmitochondria was analyzed by thiobarbituric acid assay[34]. In this assay, thiobarbituric acid...
- 9
- 491
- 0
Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt
... strainshave already been isolated and characterized [12,13], mainly from Pseudomonas aeruginosa strains [21,37–43]. The carbo-hydrate backbone of the so-called inner core region of Pseudomonas ... Thomas-Oates, J.E. & Brade, H. (1994) Preparationand structural analysis of oligosaccharide monophosphatesobtained from the lipopolysaccharide of recombinant strains of Salmonella minnesota ... Gram-negative bacteria, and their adaptability tomany different pollutants [1]. Pseudomonas stutzeri OX1 is a Gram-negative bacteriumisolated from the activated sludge of a wastewater treatmentplant,...
- 14
- 715
- 0
Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc
... A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid in Bordetellasp. ... [6,8,27] or toany other sequences available in FASTA and BLASTdatabase programs at the DNA Data Bank of Jap an. Recently, we reported the cloning and s equencing of the gene encoding 4-amino-3-hydroxybenzoate ... not have an absorbance peak at 300 nm [5]. A cofactor is not required for t he enzyme activity. In contrast, the deaminase from strain 10d contained an FAD-like cofactor, similar toD-amino acid...
- 7
- 613
- 1
Tài liệu Báo cáo khoa học: A novel c-N-methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1 ppt
... among them the tobacco alkaloid nicotine. Perhaps analysed in greatestdetail is the pathway of nicotine degradation as it takesplace in Arthrobacter nicotinovorans (formerly known as A. oxydans). ... involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1 Calin B. Chiribau1, Cristinel Sandu1, Marco Fraaije2, Emile Schiltz3and Roderich Brandsch11Institute ... on pAO1 of Arthrobacter nicotinovorans involved in the degradation of the plant alkaloid nicotine : cloning, purification and char-acterization of 2,6-dihydroxypyridine 3-hydroxylase. J. Bacteriol.183,...
- 8
- 647
- 0
Tài liệu Báo cáo khoa học: "A Novel Feature-based Approach to Chinese Entity Relation Extraction" ppt
... insufficient study in Chinese relation extraction drives us to investigate how to find an approach that is particularly appropriate for Chinese. 3 A Chinese Relation Extraction Model Due to the aforementioned ... Ohio, USA, June 2008.c2008 Association for Computational LinguisticsA Novel Feature-based Approach to Chinese Entity Relation Extraction Wenjie Li1, Peng Zhang1,2, Furu Wei1, Yuexian ... Abstract Relation extraction is the task of finding semantic relations between two entities from text. In this paper, we propose a novel feature-based Chinese relation extraction approach...
- 4
- 479
- 0
Tài liệu Báo cáo khoa học: A novel nuclear DNA helicase with high specific activity from Pisum sativum catalytically translocates in the 3¢fi5¢ direction docx
... helicase activity isdefined as the amount of enzyme that unwinds 30% of the DNA helicase substrate at 37 °Cin30min(1 %in one min). For examining the effect of DNA- interactingcompounds on DNA unwinding ... silver staining of the gel with Bio-Rad kit.1736 T N. Phan et al. (Eur. J. Biochem. 270) Ó FEBS 2003 A novel nuclear DNA helicase with high specific activity from Pisum sativum catalytically translocates ... catalyse the DNA unwinding in an ATP-dependent manner andthereby act as an essential molecular tool for cellularmachinery [2–6]. All helicases exhibit intrinsic DNA- dependent ATPase activity, ...
- 11
- 573
- 0
Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor docx
... DDBJ/EMBL/GenBankdatabases under accession number AB081457.Intron 1CGACAGgtgagt)3069 bpÀcaacagGTATATIntron 2 TTTTGTgtaaat)146 bpÀcaacagGTATAAIntron 3 AGACGGgtatga)469 bpÀtttcagGTAGTGIntron 4 TGCCAGgtatgt)119 ... 5Â-AI (A/ C)GIATG (A/ C)GIACIGTIACIAA(T/C)TA(T/C)TT-3Â (I represents an inosine residue)and 5Â-CA (A/ G)CA (A/ G)TAIATIGG (A/ G)TT (A/ G)TACAT-3Â, corresponding to amino-acid sequencesRMRTVTNYF (at transmembrane ... Todate, DTKR, NKD, and STKR have been cloned as tachykinin-related peptide receptors or receptor candidatesCorrespondence to H. Satake, Wakayamadai 1-1-1, Shimamoto-cho,Mishima-gun, Osaka 618À8503,...
- 9
- 472
- 0
Báo cáo khoa học: A novel mechanism of V-type zinc inhibition of glutamate dehydrogenase results from disruption of subunit interactions necessary for efficient catalysis doc
... The Authors Journal compilation ª 2011 FEBS A novel mechanism of V-type zinc inhibition of glutamate dehydrogenase results from disruption of subunit interactions necessary for efficient catalysis Jaclyn ... that the V-type inhibition produced with glutamate as the substrate results from disruption of subunit interactions necessary for efficient cataly-sis rather than by a direct effect on the active ... anamplitude and rate constant for the pre-steady statephase to be calculated. The parameters for both thesteady state phase and the pre-steady state phase aregiven in Table 2.Effects of zinc on cofactor...
- 12
- 544
- 0
Báo cáo khoa học: A novel ErbB2 epitope targeted by human antitumor immunoagents ppt
... epitopes and signaling mechanisms thatcontrol tumor cell and cardiomyocyte viability, butalso to exploit this epitope as a novel potential thera-peutic target to mitigate anti -ErbB2- associated cardio-toxicity ... ELISAs[11], all of the available mAbs against ErbB2, such asHerceptin (trastuzumab), 2c4 (pertuzumab), 7c2, andMAB74, recognize different epitopes from that ofEDIAs.The apparent binding affinity ... (Qiagen, Valencia, CA, USA), and HRP-conju-gated goat anti- [human (affinity-isolated) IgG1] (Fc-specific)(Sigma, St Louis, MO, USA). Erb-hcAb was prepared aspreviously described [9]. N-28 was a generous...
- 11
- 373
- 0
Báo cáo khoa học: A novel prokaryotic L-arginine:glycine amidinotransferase is involved in cylindrospermopsin biosynthesis potx
... that differs from that of the eukaryotic l-arginine:glycine amidinotransferases.AbbreviationsAGAT, human L-arginine:glycine amidinotransferase; AmtA, L-arginine:lysine amidinotransferase; ANS, ... ANS, 8-anilino-naphthalene-1-sulfonate; StrB,L-arginine:inosamine phosphate amidinotransferase; StrB1, Streptomyces griseus L-arginine:inosamine phosphate amidinotransferase. 3844 FEBS Journal 277 ... c-guanid-inobutyric acid and b-guanidinoproprionic acid weretested as amidino group donors. l-Alanine, b-alanine,c-aminobutyric acid, ethanolamine, taurine, l-lysine, a- amino-oxyacetic acid and...
- 17
- 544
- 0
Báo cáo khoa học: A large complex mediated by Moc1, Moc2 and Cpc2 regulates sexual differentiation in fission yeast ppt
... CGATTACGCCTCTGTGATTC Moc2 tagging primers Moc2- W CGTGGTTTAGATATTCCC Moc2- X GGGGATCCGTCGACCTGCAGCGTACGA CCACCAGGATTGAGCAC Moc2- Y GTTTAAACGAGCTCGAATTCATCGATGGGTTACGTGCATCTGTG Moc2- Z CATGAGCTCAAAGCCTGMoc3 tagging ... TCTCCCGGGCATGGTTTATTCTCCTATGTCmoc1–R–SalI TATGTCGACTCACCGACGTTGTGTATCTAC moc2 R–SalI TTTAGTCGACTTACCACCAGGATTGAGCACmoc3–R–SalI CCAGTCGACTGACTGTCGTACCGTAATTCGmoc4–R–SalI GATGTCGACTCAAGGAGATTGCTTAATAGpGBKT7/pREP1 ... primersMoc4-W CCTAAGCTGTGCGTTCAATCMoc4-X GGGGATCCGTCGACCTGCAGCGTACGAAGGAGATTGCTTAATAGTTGCACMoc4-Y GTTTAAACGAGCTCGAATTCATCGATGTTGTTATGCAATCTGGGTGAGMoc4-Z GATTCATGCGTATCGCATTGCRpl32-2 tagging primersRpl32-2-W...
- 18
- 383
- 0
Báo cáo khoa học: " A novel b-glucan produced by Paenibacillus polymyxa JB115 induces nitric oxide production in RAW264.7 macrophages" docx
... potential use of the novel β-glucan purified from P. polymyxa JB115 as an immunostimulant or as an adjuvant of some animal vaccines. β-glucan-induced nitric oxide production 167Fig. 5. β-glucan ... Park SC. Polysaccharides isolated from Phellinus baumii stimulate murine splenocyte proliferation and inhibit the lipopoly-saccharide-induced nitric oxide production in RAW264.7 murine macrophages. ... Zhi-Qiang Chang et al.Fig. 2. β-glucan induced nitric oxide production in RAW264.7 macrophages. RAW264.7 cells were treated with either LPS (0.5μg/ml) or β-glucan. Data represents the mean ±...
- 3
- 281
- 0
Từ khóa: báo cáo khoa học mẫubáo cáo khoa học y họcbáo cáo khoa học sinh họcbáo cáo khoa học nông nghiệpbáo cáo khoa học lâm nghiệpNghiên cứu tổ hợp chất chỉ điểm sinh học vWF, VCAM 1, MCP 1, d dimer trong chẩn đoán và tiên lượng nhồi máu não cấpđề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giảiBiện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANNGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDETrả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Phát triển du lịch bền vững trên cơ sở bảo vệ môi trường tự nhiên vịnh hạ longNghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chếTìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tinSở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIXTổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)BT Tieng anh 6 UNIT 2Tăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)Đổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namHIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀM