Báo cáo hóa học: " Datura stramonium L poisoning in a geophagous child: a case report" potx

Báo cáo hóa học: " Datura stramonium L. poisoning in a geophagous child: a case report" potx

Báo cáo hóa học: " Datura stramonium L. poisoning in a geophagous child: a case report" potx

... anemia with a hemoglobin level of 7.8 g/dl. Aspartate aminotransferase, alanine aminotransferase, creatine kinase, lactic dehydrogenase, and gamma glu- tamyl transpeptidase levels were normal. ... Jaballah Abstract Datura stramonium L. (DS) is a wild-growing plant widely distributed and easily accessible. It contains a variety of toxic anticholinergic alkaloids such as atropine, hy...
Ngày tải lên : 21/06/2014, 03:20
  • 3
  • 341
  • 0
Báo cáo hóa học: " Simultaneous measurements of kinematics and fMRI: compatibility assessment and case report on recovery evaluation of one stroke patient" potx

Báo cáo hóa học: " Simultaneous measurements of kinematics and fMRI: compatibility assessment and case report on recovery evaluation of one stroke patient" potx

... of inserting the actual kinematics para- meter s in the generation of cortical activati on maps was evaluated comparing the two models. A high-pass filter was automatically included in the analysis ... 23:1524-1532. 28. Lancaster JL, Rainey LH, Summerlin JL, Freitas CS, Fox PT, Evans AE, Toga AW, Mazziotta JC: Automated labeling of the human brain: A preliminary report on the developm...
Ngày tải lên : 19/06/2014, 08:20
  • 17
  • 618
  • 0
báo cáo hóa học: " Efficacy of motor imagery in post-stroke rehabilitation: a systematic review" ppt

báo cáo hóa học: " Efficacy of motor imagery in post-stroke rehabilitation: a systematic review" ppt

... mean change scores than the mini- mal clinically relevant difference in the ARAT and in the FMSA respectively. The methodological quality of included randomized con- trolled trials with small ... Hos- pital of Zurich, who designed and conducted the electronic database search, Jan Kool, Martina Spiess and Cornelia Barth for critical remarks and Katharina Schlatter and Arianne Knüsel for...
Ngày tải lên : 19/06/2014, 10:20
  • 10
  • 359
  • 0
báo cáo hóa học: " Secreted phospholipase A2 activity in experimental autoimmune encephalomyelitis and multiple sclerosis" potx

báo cáo hóa học: " Secreted phospholipase A2 activity in experimental autoimmune encephalomyelitis and multiple sclerosis" potx

... the devel- opment of EAE symptoms, including correlated morphological changes in the spinal cord. Finally, this same urinary assay was applied to randomly collected urine samples from MS patients ... phospholipase A2 (sPLA2) activity and clinical dis-ease in EAE rats treated with sPLA2 inhibitor CHEC-9Figure 1 Secreted phospholipase A2 (sPLA2) activity and clin- ical disease in EAE ra...
Ngày tải lên : 19/06/2014, 22:20
  • 8
  • 375
  • 0
báo cáo hóa học:" Varicella zoster virus acute retinal necrosis following eye contusion: case report" pot

báo cáo hóa học:" Varicella zoster virus acute retinal necrosis following eye contusion: case report" pot

... ultrasonography were normal. Leukocyte count, hematocrit and activated partial tromboplastin time (APTT) were normal, liver tests showed elevated levels of alaninaminotranspherase (ALT; 2.63 ukat /l) . ... no plasma cell neoplasia. In two weeks, intravenous acyclovir was followed by oral acyclovir (5 × 400 mg daily). In the right eye, large foci of retinal atrophy with reduced inflammator...
Ngày tải lên : 20/06/2014, 04:20
  • 5
  • 266
  • 0
báo cáo hóa học:" Occupationally related bilateral calcific tendonitis of Flexor carpi ulnaris: case report" pdf

báo cáo hóa học:" Occupationally related bilateral calcific tendonitis of Flexor carpi ulnaris: case report" pdf

... correlates with occupa- tionally related repetitive strain. Case report A 42 year old male Hospital porter presented to our out- patient clinic with bilateral wrist pain. The pain was local- ised ... occupationally related. This was treated conservatively with avoidance of aggravating movement, resting splints and anti inflammatory medication when acute flare ups occurred. Since avoidance...
Ngày tải lên : 20/06/2014, 04:20
  • 2
  • 247
  • 0
báo cáo hóa học:" Charcot foot reconstruction with combined internal and external fixation: case report" pot

báo cáo hóa học:" Charcot foot reconstruction with combined internal and external fixation: case report" pot

... the first metatarsal to the medial malleolus was made. Dis- section was carefully carried out, with care to maintain a full-thickness dorsal and medial flap. The naviculo cu- neiform and metatarsocuneiform ... right foot revealed a Charcot homolateral tarsometatarsal joint dislocation, medial displacement of the navicular, inferior subluxation of the ta rsometatarsal joints, as well as hy...
Ngày tải lên : 20/06/2014, 04:20
  • 9
  • 588
  • 0
báo cáo hóa học: " N-Acetyl L-Cysteine does not protect mouse ears from " pot

báo cáo hóa học: " N-Acetyl L-Cysteine does not protect mouse ears from " pot

... Occupational Safety and Health, C-27, 4676 Columbia Parkway, Cincinnati, OH 45226, USA Full list of author information is available at the end of the article Davis et al. Journal of Occupational ... with normal-hearing strains (i.e. CBA/CaJ and a congenic B6 strain (B6.CAST+ahl mouse) with the Ahl allele replaced with the wild-type Castaneous strain allele). Using immunohistochemical tech...
Ngày tải lên : 20/06/2014, 00:20
  • 5
  • 239
  • 0
Báo cáo hóa học: " Superhydrophobic poly(L-lactic acid) surface as potential bacterial colonization substrate" pptx

Báo cáo hóa học: " Superhydrophobic poly(L-lactic acid) surface as potential bacterial colonization substrate" pptx

... substances (EPS). In fact, as a Gram-negative bacterium, the cell wall of P. aeruginosa contains lipids, proteins, and lipopolysaccha rides (LPS), while the cell wall of the Gram-positive bacteria, ... 10-fold serial dilutions in saline sol ution (NaCl 0.9%) and plated in TSA, in triplicate. Prior to colony enumeration, the plates were incubated for 24 h at 37°C. Bacteria removal as...
Ngày tải lên : 20/06/2014, 23:20
  • 9
  • 293
  • 0
Báo cáo khoa học: Characterization of L-aspartate oxidase and quinolinate synthase from Bacillus subtilis potx

Báo cáo khoa học: Characterization of L-aspartate oxidase and quinolinate synthase from Bacillus subtilis potx

... ATCRSCAHCPWMAMNGLQAIAEALEQEGSN HEVHVDERLRERALVPLN 336 NADA_SALTY LLEAPTAGEG ATCRSCAHCPWMAMNGLKAIAEGLEQGGAA HEIQVDAALREGALLPLN 336 NADA_BACSU QIESLN PDMCPCLTMNRIDLPHLLWSLEQIEKGEP SGVIKVPKAIQEDALLALN 362 NADA_HELPY ... 89 NADA_SYNY3 MFTAVAPPQETLP RDLVGAIQSLKKELNAVILAHYYQEAAIQDIADYLG DSLGLSQQAASTD ADVIVFAGVHFMAETAKILNPHK 85 NADA_SYNEC MFTAVAPPQETLP RDLVGAIQSLKKELNAVILAHYYQEAAIQDIADYLG DSLGL...
Ngày tải lên : 30/03/2014, 02:20
  • 18
  • 350
  • 0

Xem thêm

Từ khóa: