Báo cáo khoa học: "THE LEXICAL EXPRESSIONS SEMANTICS OF COMPARATIVE IN A MULTI-LEVEL SEMANTIC PROCESSOR" ppt

... discussed in any detail. Rayner and Banks (1988) describe a logic programming approach to obtaining a parse and an initial logical formula for sentences containing a fairly broad range of CEs. ... re- quire a slightly different approach. Since we are dealing with a mass aggregation rather than a set, the *CARDINALITY* mapping is inapplicable. To measure the size of an aggregation we ... attribute ambiguity when there is more than one applicable MTrans rule for a particular EL mapping predicate. We define a candidate mapping as any DML mapping that, on the basis of an applicable...

Báo cáo khoa học: "THE SYNTAX AND SEMANTICS OF USER-DEFINED MODIFIERS IN A TRANSPORTABLE NATURAL LANGUAGE PROCESSOR" pot

... complex domains are a 2~al gTz, des domain, giving course grades for students in an academic department, and a bu~di~tg ~rgsvtizatiovt domain, containing information on the floors, wings, corridors, ... in ACQUIRING VERBS FOR STUDENT: A STUDENT CAN pass a course fail a course take a course from an instructor make a grade from an instructor make a grade in a course In Stage 2, Prep learns ... Stage 1, Prep asks the user to name each ent~.ty, or conceptual data item, of the domain. As each entity name is given, Prep asks for several simple kinds of information, as in ENTITY NAME?...

Tài liệu Báo cáo khoa học: "The Lexical Component of Natural Language Processing" docx

... functions. As yet, no adequate system for natural language processing has approached human levels of performance. Of the various problems that natural language processing has re- vealed, polysemy ... co-occurrence statistics to create a semantic hyperspace where each word, regardless of its polysemy, is represented as a single vector. Each approach has strengths and limitations; some combination ... generally involves a parser, a lexicon, and some ad hoc rules for using linguistic context to identify the context-appropriate sense. A statistical approach generally involves the use of word...

Tài liệu Báo cáo khoa học: The tandemly repeated domains of a b-propeller phytase act synergistically to increase catalytic efﬁciency doc

... InsP6gradually into InsP5, InsP4,and the final product – Ins(2,4,6)P3and Ins(1,3,5)P3–via two alternative pathways [14].Bacterial BPPs containing two tandemly repeateddomains (dual domains) ... can increasethe amount of available phosphate by interacting together. Additionally,fusing PhyH-DI to a single-domain phytase appears to be an efficient wayto improve the activity of the latter.IntroductionPhytate ... wasdetermined using the Bradford assay with BSA as thestandard [28].Phytase activity assayPhytase activity was determined by measuring the amount of phosphate released from InsP6using a modified...

Tài liệu Báo cáo khoa học: Suppressed catalytic efﬁciency of plasmin in the presence of long-chain fatty acids Identiﬁcation of kinetic parameters from continuous enzymatic assay with Monte Carlo simulation ppt

... the amidolytic activity of two truncated plasmin variants was examined(Fig. 8). Miniplasmin (des-kringle 1-4 plasmin) con-tains the kringle 5 and the catalytic domain of plas-min, whereas microplasmin ... numbers, and the absorbance at 405 nm was measured. The mean and standard deviation(dotted lines) of five measurements are shown for both panels. A. Tanka-Salamon et al. Fatty acids as plasmin inhibitorsFEBS ... Suppressed catalytic efficiency of plasmin in the presence of long-chain fatty acidsIdentification of kinetic parameters from continuous enzymaticassay with Monte Carlo simulationAnna Tanka-Salamon1,...

Tài liệu Báo cáo khoa học: The thioredoxin-independent isoform of chloroplastic glyceraldehyde-3-phosphate dehydrogenase is selectively regulated by glutathionylation docx

... and puriﬁcation of Arabidopsis A 4-GAPDHThe sequence encoding the putative mature form of the A. thaliana plastidial A 4-GAPDH isoform (GapA-1 cDNAAt3g26650 provided by TAIR, Stanford, CA, ... & Branlant G(1998) Comparative study of the catalytic domain of phosphorylating glyceraldehyde-3-phosphate dehydro-genases from bacteria and archaea via essential cysteineprobes and site-directed ... werewithdrawn at the indicated time points and the remaining NADPH-dependent activity was determined. Activity is given as a percent-age of the initial activity.Glutathionylation of chloroplastic GAPDH...

Tài liệu Báo cáo khóa học: The C-terminal domain of Escherichia coli Hfq increases the stability of the hexamer ppt

... protease. This cleavage generates an 83amino acid fragment containing the N-terminal domainconserved in bacterial Hfqs (% 65 amino acids in HfqEc)and a short part of the C-terminal domain which is ... Figure 4A shows that thenative form of Hfq has an apparent molecular mass of 50 ± 10 kDa, while the unfolded state of Hfq has anaverage apparent molecular mass of 12 ± 5 kDa. Thisindicates that ... with anti-Hfq Igs. Cytochrome c(12.4 kDa), ovalbumin (44 kDa), bovine serum albumin (67 kDa),aldolase (158 kDa) and catalase (232 kDa) were used as standards tocalibrate the gradient and are indicated...

Tài liệu Báo cáo khoa học: Mg2+-modulated KMnO4 reactivity of thymines in the open transcription complex reﬂects variation in the negative electrostatic potential along the separated DNA strands ppt

... volume integration and area integration of quadrilateral contours encompassing these bands,respectively. For area integration, the lowest intensity point in the graph was used as the horizontal baseline ... the calculation of the contribution of individualbases to the integrated intensity of overlapping DNAbands.Determination of the promoter occupancyProducts of the Klenow reaction can also include ... of a Molecular Dynamics Phosphorimager. Integrated intensities of bands (or groups of bands) and their intensity proﬁlesalong gel lanes were obtained with the help of the image-quant software,...

Tài liệu Báo cáo khoa học: "The grapho-phonological system of written French: Statistical analysis and empirical validation" pdf

... tested in a immediate naming and a delayed naming task with the same stimuli. In the immediate naming condition, participants were instructed to read aloud pseudowords as quickly and as accurately ... list included 32 pairs of pseudowords with contrasting average values of entropy and close values of average grapheme frequency. In addition, stimuli in a matched pair were controlled for a ... explanation of rule- like behavior. Is the language user's capacity to exploit print-sound regularities, for instance to generate a plausible pronunciation for a new, unfamiliar string of...

Tài liệu Báo cáo khoa học: The isolation and characterization of cytochrome c nitrite reductase subunits (NrfA and NrfH) from Desulfovibrio desulfuricans ATCC 27774 Re-evaluation of the spectroscopic data and redox properties ppt

... compriseCytc_DdesCytc_DgigNrfH_WsucNrfH_SdelNrfH_DdesCymA_SputNapC_RsphNapC_PpanNapC_AbraNapC_Paer VDAPADMV.IKAPAGAKVTKAPV AFSHKGHASM VDVPADGAKIDFIAGGE.KNLTV VFNHSTHKDV MNKSKFLVYSSLVVFAI ALGLFVYLVNASKALSYLSSDPKACI NCHVM. NPQYAT MKNSNFLKYAALGAFIVAIGFFVYMLNASKALSYLSSDPKACI ... and4) high molecular mass bands of approximately 110 kDaand > 200 kDa were visible, as well as a faint band at37 kDa, suggesting the presence of dimers. All of the bandsstained positively ... propertiesMaria Gabriela Almeida1, So a Macieira2, Luisa L. Gonçalves1, Robert Huber2, Carlos A. Cunha1,Maria Joaõ Romaõ1, Cristina Costa1, Jorge Lampreia1, Jose´J. G. Moura1and...

Xem thêm

Từ khóa: báo cáo khoa học mẫu báo cáo khoa học y học báo cáo khoa học sinh học báo cáo khoa học nông nghiệp báo cáo khoa học lâm nghiệp báo cáo khoa học thủy sản Nghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoại Nghiên cứu tổ hợp chất chỉ điểm sinh học vWF, VCAM 1, MCP 1, d dimer trong chẩn đoán và tiên lượng nhồi máu não cấp Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Phát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninh Phát triển du lịch bền vững trên cơ sở bảo vệ môi trường tự nhiên vịnh hạ long Nghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chế Tìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tin Thơ nôm tứ tuyệt trào phúng hồ xuân hương Thiết kế và chế tạo mô hình biến tần (inverter) cho máy điều hòa không khí Sở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIX Tranh tụng tại phiên tòa hình sự sơ thẩm theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn xét xử của các Tòa án quân sự Quân khu (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vật Nguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật Trách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)BÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘI TÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ QUẢN LÝ VÀ TÁI CHẾ NHỰA Ở HOA KỲ