0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Báo cáo khoa học >

Báo cáo khoa học: A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents pdf

Báo cáo khoa học: A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents pdf

Báo cáo khoa học: A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents pdf

... Novel glycogen-targeting subunit of PP1 A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents Shonagh ... ATC CAC TTT ATC TGA gacgaggcgcctgcggccgacggcggaaaacaccaaaggcacccgggggcggggcgacccgatgtggcggggaggagtag 920276 I H F I * 279 9 21 gagagaccaggattggcgggagcggtccaagggagtc 957Fig. 1. (A) Diagram of ... QLQRDALRHFAPCPPRTRGLQDARIALEPALEPGFAARLQAQRICLERADAGPLGVAGSHUMAN R3E 11 9 QLQRDALRHFAPCQPRARGLQEARAALEPASEPGFAARLLTQRICLERAEAGPLGVAGSMOUSE R3E 17 8 ARVLDLAYEKRVSVRWSADGWRSLRESPASYAGPAPSPPRADRFAFRLPAPPVGGTLLFRAT...
  • 12
  • 381
  • 0
Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx

Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx

... (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primersfor unmethylated DNA were: 5¢-GAAGTAGGTGGAGTATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCTACTT-3¢ (antisense).Caspase 3 activityCells ... (OccWT) and variant occludin in apoptosis and invasion, as determined by assay, werevealed that exon 9 played a major role in the induc-tion of mitochondria-mediated apoptosis and thereduction of ... is inactivated by increased expression of this protein in HeLa cells [12 ]. Our data showed that OccWTactivated only ERK1 ⁄ 2 and not p38 and JNK.On the basis of our data, exon 9 of occludin...
  • 12
  • 613
  • 0
Báo cáo khoa học: A novel serine protease highly expressed in the pancreas is expressed in various kinds of cancer cells potx

Báo cáo khoa học: A novel serine protease highly expressed in the pancreas is expressed in various kinds of cancer cells potx

... preferentially expressed in brain.Biochim Biophys Acta 13 50, 11 14 . 11 Ogawa K, Yamada T, Tsujioka Y, Taguchi J, Takaha-shi M, Tsuboi Y, Fujino Y, Nakajima M, YamamotoT, Akatsu H, Mitsui S & Yamaguchi ... hippostasin ⁄ KLK 11 is up -regulated in ovarian and prostate cancers [17 ]. Recent experimental datasuggest that human kallikreins promote or inhibittumor growth, angiogenesis, invasion, metastasis ... 54, 419 –426. 12 Mitsui S, Tsuruoka N, Yamashiro K, Nakazato H &Yamaguchi N (19 99) A novel form of human neuropsin, a brain-related serine protease, is generated by alterna-tive splicing and is expressed...
  • 13
  • 483
  • 0
Báo cáo khoa học: A novel transmembrane topology of presenilin based on reconciling experimental and computational evidence pptx

Báo cáo khoa học: A novel transmembrane topology of presenilin based on reconciling experimental and computational evidence pptx

... six-transmembrane domain structure of presenilin 1. J Biol Chem 272, 12 047 12 0 51. 24 Nakai T, Yamasaki A, Sakaguchi M, Kosaka K, Miha-ra K, Amaya Y & Miura S (19 99) Membrane topology of Alzheimer’s ... ER-retention, nicastrin-binding and gamma-secretase activity. Embo J 23, 4738–4748. 14 Tomita T, Takikawa R, Koyama A, Morohashi Y,Takasugi N, Saido TC, Maruyama K & Iwatsubo T (19 99) C terminus of presenilin ... for aneight-transmembrane-domain topology for Caenorhabdi-tis elegans and human presenilins. Proc Natl Acad SciUSA 95, 710 9– 711 4.23 Lehmann S, Chiesa R & Harris DA (19 97) Evidence fora...
  • 7
  • 458
  • 0
Báo cáo khoa học: A novel four transmembrane spanning protein, CLP24 A hypoxically regulated cell junction protein pdf

Báo cáo khoa học: A novel four transmembrane spanning protein, CLP24 A hypoxically regulated cell junction protein pdf

... *Agtcgcccttctcagcgttccatcgatgcacacctgctatcgtggaacagcctagaaaccaagggactccaccaccaagtcacttcccctgctcgtgcagaggcacgggatgagtctgggtgacctctgcgccatgcgtgcgagacacgtgtgcgtttactgttatgtcggtcatatgtctgtacgtgtcgtgggccaacctcgttctgcctccagctttcctggttagcgcaacgcggctccacgaccacacgcacttcagggtggaagctggaagctgagacacaggttaggtggcgcgaggctgccctgcgctccgctttgctttgggattaatttattctgcatctgctgagaggggcaccccagccatatcttacactttggtaaagcagaaaaccaggaaaattttcttaaaatatccacaatattccttgagtgagtcagaatctatagccggttagtgatggtttcaggcagaatcgtgttcgtgtctgttttgctcgattcctttcctaagttaaataaatgcaagcctctgaacttctgtctataaaaaaaaaaaaaaaaa 1 51 1 01 1 51 2 01 2 51 3 01 3 51 4 01 4 51 5 01 5 51 6 01 16 51 11 7 01 287 51 458 01 61 8 51 789 01 959 51 111 10 01 128 10 51 145 11 01 1 61 115 1 17 8 12 01 195 12 51 211 13 01 13 51 14 01 14 51 15 01 15 51 16 01 16 51 17 01 17 51 18 01 18 51 50 10 0 15 0200250300350400450500550600650 10 7002775044800608507790094950 11 0 10 00 12 7 10 50 14 4 11 00 16 0 11 50 17 7 12 00 19 4 12 50 210 13 00226 13 50 14 00 14 50 15 00 15 50 16 00 16 50 17 00 17 50 18 00 18 50 18 71 PMP22 ... *Agtcgcccttctcagcgttccatcgatgcacacctgctatcgtggaacagcctagaaaccaagggactccaccaccaagtcacttcccctgctcgtgcagaggcacgggatgagtctgggtgacctctgcgccatgcgtgcgagacacgtgtgcgtttactgttatgtcggtcatatgtctgtacgtgtcgtgggccaacctcgttctgcctccagctttcctggttagcgcaacgcggctccacgaccacacgcacttcagggtggaagctggaagctgagacacaggttaggtggcgcgaggctgccctgcgctccgctttgctttgggattaatttattctgcatctgctgagaggggcaccccagccatatcttacactttggtaaagcagaaaaccaggaaaattttcttaaaatatccacaatattccttgagtgagtcagaatctatagccggttagtgatggtttcaggcagaatcgtgttcgtgtctgttttgctcgattcctttcctaagttaaataaatgcaagcctctgaacttctgtctataaaaaaaaaaaaaaaaa 1 51 1 01 1 51 2 01 2 51 3 01 3 51 4 01 4 51 5 01 5 51 6 01 16 51 11 7 01 287 51 458 01 61 8 51 789 01 959 51 111 10 01 128 10 51 145 11 01 1 61 115 1 17 8 12 01 195 12 51 211 13 01 13 51 14 01 14 51 15 01 15 51 16 01 16 51 17 01 17 51 18 01 18 51 50 10 0 15 0200250300350400450500550600650 10 7002775044800608507790094950 11 0 10 00 12 7 10 50 14 4 11 00 16 0 11 50 17 7 12 00 19 4 12 50 210 13 00226 13 50 14 00 14 50 15 00 15 50 16 00 16 50 17 00 17 50 18 00 18 50 18 71 PMP22 ... *Agtcgcccttctcagcgttccatcgatgcacacctgctatcgtggaacagcctagaaaccaagggactccaccaccaagtcacttcccctgctcgtgcagaggcacgggatgagtctgggtgacctctgcgccatgcgtgcgagacacgtgtgcgtttactgttatgtcggtcatatgtctgtacgtgtcgtgggccaacctcgttctgcctccagctttcctggttagcgcaacgcggctccacgaccacacgcacttcagggtggaagctggaagctgagacacaggttaggtggcgcgaggctgccctgcgctccgctttgctttgggattaatttattctgcatctgctgagaggggcaccccagccatatcttacactttggtaaagcagaaaaccaggaaaattttcttaaaatatccacaatattccttgagtgagtcagaatctatagccggttagtgatggtttcaggcagaatcgtgttcgtgtctgttttgctcgattcctttcctaagttaaataaatgcaagcctctgaacttctgtctataaaaaaaaaaaaaaaaa 1 51 1 01 1 51 2 01 2 51 3 01 3 51 4 01 4 51 5 01 5 51 6 01 16 51 11 7 01 287 51 458 01 61 8 51 789 01 959 51 111 10 01 128 10 51 145 11 01 1 61 115 1 17 8 12 01 195 12 51 211 13 01 13 51 14 01 14 51 15 01 15 51 16 01 16 51 17 01 17 51 18 01 18 51 50 10 0 15 0200250300350400450500550600650 10 7002775044800608507790094950 11 0 10 00 12 7 10 50 14 4 11 00 16 0 11 50 17 7 12 00 19 4 12 50 210 13 00226 13 50 14 00 14 50 15 00 15 50 16 00 16 50 17 00 17 50 18 00 18 50 18 71 PMP22...
  • 9
  • 349
  • 0
Tài liệu Báo cáo khoa học: Aggregative organization enhances the DNA end-joining process that is mediated by DNA-dependent protein kinase pdf

Tài liệu Báo cáo khoa học: Aggregative organization enhances the DNA end-joining process that is mediated by DNA-dependent protein kinase pdf

... aggregation has been characterizedfor major nucleoproteins including histone H1 [14 ],topoisomerase II [15 ], lamin B1 [16 ] and SAF -A (hnRNP U) [17 ].It is known that the aggregation of DNA is ... DNA (0 .1 lg) (Fig. 1C, lanes 7 and 14 ). After a 2.7 kbp linearized-plasmid DNA was coaggregatedwith human nuclear fractions, an EJ reaction wasinitiated by the addition of ATP as a cofactor into ... wort-mannin-inactivated aggregates was alsotested (lanes 6–9). The aggregate and thesupernatant (sup.) were analyzed separately(lanes 10 and 11 ). The conditions in lanes 4,5 and 9 are parallel...
  • 13
  • 458
  • 0
Báo cáo khoa học: A novel mechanism of V-type zinc inhibition of glutamate dehydrogenase results from disruption of subunit interactions necessary for efficient catalysis doc

Báo cáo khoa học: A novel mechanism of V-type zinc inhibition of glutamate dehydrogenase results from disruption of subunit interactions necessary for efficient catalysis doc

... 2 011 )doi :10 .11 11/ j .17 42-4658.2 011 .08240.xBovine glutamate dehydrogenase is potently inhibited by zinc and the majorimpact is on Vmaxsuggesting a V-type effect on catalysis or product release.Zinc ... compilation ª 2 011 FEBSthe glutamate binding domain. Both regions are part of the $ 18 ° movement of the NAD binding domainduring catalysis [30, 31] . Therefore it is possible that zinc, binding ... glutamate dehydrogenase. 314 0 FEBS Journal 278 (2 011 ) 314 0– 315 1 ª 2 011 The Authors Journal compilation ª 2 011 FEBSwith near equal affinity, although NAD(H) has anadditional binding site per subunit...
  • 12
  • 544
  • 0
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... 5A) . TheFdx ⁄ CYP17 5A1 ratio was saturated at 8 : 1, and theturnover rate at an Fdx ⁄ CYP17 5A1 ratio of 8 : 1 was4.9-fold greater than that at a ratio of 1 : 1 (Fig. 5B).The addition of appropriate ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 3 21 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... and a single bandwas observed (Fig. 1A) . These purification steps aresummarized in Table 1. The purified protein gave a UV–visible spectrum with a broad absorption peak at400 nm and a peak at...
  • 14
  • 617
  • 0
Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt

Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt

... evolutionary aspects of invertebrate tachykinin and tachykinin-related peptideAtsuhiro Kanda, Kyoko Takuwa-Kuroda, Masato Aoyama and Honoo SatakeSuntory Institute for Bioorganic Research, Osaka, JapanTachykinins ... tachykinins: a review. Zool Sci 5,533–549.7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy-ama M, Minakata H, Chiba T, Metoki H, Satou Y &Satoh N (2004) Tachykinin and tachykinin receptor of an ... BioorganicResearch, 1- 1 -1 Wakayamadai, Shimamoto-cho, Mishima-gun, Osaka 618 -8503, JapanFax: + 81 75 962 211 5Tel: + 81 75 962 3743E-mail: kanda@sunbor.or.jpDatabaseNucleotide sequence data are...
  • 11
  • 595
  • 0
Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt

Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt

... theconcentration of substrates gave a family of parallellines (Fig. 1) , indicating that the reaction mechanism is a ping-pong mechanism. This result demonstrated that the GPX mimic, 6-CySeCD, has the ... mito-chondrial swelling and a decrease in mitochondria integrity.TBARS content in ferrous sulfate ⁄ ascorbate-treatedmitochondria was analyzed by thiobarbituric acid assay[34]. In this assay, thiobarbituric ... Yasuhisa K & Tadashi M (19 86) Artificialreceptors for amino acids in water. Local environmentaleffect on polar recognition by 6A- amino-6B-carboxy- and 6B-amino- 6A- carboxy-beta-cyclodextrins. JAmChem...
  • 9
  • 491
  • 0

Xem thêm

Từ khóa: báo cáo khoa họcbáo cáo khoa học mẫubáo cáo khoa học y họcbáo cáo khoa học sinh họcbáo cáo khoa học nông nghiệpbáo cáo khoa học lâm nghiệpNghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thốngNghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoạiNghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THzGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitTrả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Phát hiện xâm nhập dựa trên thuật toán k meansThơ nôm tứ tuyệt trào phúng hồ xuân hươngThiết kế và chế tạo mô hình biến tần (inverter) cho máy điều hòa không khíSở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIXChuong 2 nhận dạng rui roTranh tụng tại phiên tòa hình sự sơ thẩm theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn xét xử của các Tòa án quân sự Quân khu (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtGiáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtNguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtBÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIĐổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namMÔN TRUYỀN THÔNG MARKETING TÍCH HỢP