Báo cáo khoa học: C-terminal truncated cannabinoid receptor 1 coexpressed with G protein trimer in Sf9 cells exists in a precoupled state and shows constitutive activity ppt

... was 5¢-GC G GAT CC G ACC ATGGCG AAG TCG ATC CTA GAT GGC-3¢. The reverseprimer for the full-length CB1 gene, with EcoRI and NotIrestriction sites, was 5¢-GAA T GC GGC CGC TCA CTTTTC GAA TTG ... oligomer. Our results show that at least thedistal C-terminal tail ( 418 –472) is not involved in CB1( 417 ) G +G Anti-Flag M2 IgGAnti-His tag IgGAnti-His tag IgGAnti -G i1 /G i2IgG Receptor Receptor G Gi1Fig. ... from Sigma-Aldrich Chemie GmbH(Munich, Germany). Anti-Gai1⁄ Gai2IgG was purchasedfrom Calbiochem (Merck KGaA, Darmstadt, Germany).Anti-ﬂag M2 IgG agarose was obtained from Sigma-Aldrich...

Báo cáo khoa học: Identiﬁcation of sites of phosphorylation by G-protein-coupled receptor kinase 2 in b-tubulin ppt

... + 81 35992 10 33,E-mail: tatsuya.haga@gakushuin.ac.jpAbbreviations: GPCR, G- protein- coupled receptor; GRK, G- protein- coupled receptor kinase; PP 2A, phosphatase 2A; MAP,microtubule-associated ... sites in M2receptors [14 ]. These regions are assumed to undergo a conformational change on agonist binding and to beinvolved in the interaction with G- proteins [16 ,17 ]. Further-more, mastoparan, ... activates G- proteins [18 ], has been shown tostimulate GRK1 [15 ] and GRK2, particularly in thepresence of G- protein bc subunits [14 ]. All these peptides with GRK2-stimulating activity, including...

Tài liệu Báo cáo khoa học: Differentiation stage-dependent preferred uptake of basolateral (systemic) glutamine into Caco-2 cells results in its accumulation in proteins with a role in cell–cell interaction pptx

... SYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK QEYDESGPSIVHR KCFADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPR ... KCFADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPR MLITILGTVKPNANR IALDFQR GNDVAFHFNPRFNENNRR VIVCNTKLDNNWGREER QSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMIBFig. ... role in maintaining arginine homeostasis in post-weaning growing pigs. J Nutr 12 7, 2342–2349. 61 Quan J, Fitch MD & Fleming SE (19 98) Rate at whichglutamine enters TCA cycle in uences carbon...

Báo cáo khoa học: Methods to monitor the quaternary structure of G protein-coupled receptors doc

... well validated GPCR radioligands areavailable, attempts have been made to generate stand-ard curves of GPCR ligand-binding site numberagainst ﬂuorescence or luminescence signals to allowabsolute ... Using the histamine H1 receptor as a model, Bakker et al. [ 41] showed that although singlepoint mutations in both transmembrane region III and transmembrane region VI prevented binding of antag-onist ... in cells expres-sing increasing concentrations of GPCR–Rluc and GPCR–GFP2while maintaining a constant GPCR–GFP2: GPCR–Rluc ratio of 1. In the case of speciﬁc GPCR dimers,BRET levels are...

Báo cáo khoa học: Poly(ADP-ribose) polymerase-1 protects excessive DNA strand breaks from deterioration during repair in human cell extracts pot

... cross-linking assay, we reveal that PARP -1 isalways involved in repair of a uracil-containing oligonucleotide and that itbinds to the damaged DNA during the early stages of repair. Inhibition ... ofPARP -1 in cellular BER. Numerous studies have indi-cated that PARP -1 may play an important role in living cells, as PARP -1- deﬁcient cells are geneticallyunstable and sensitive to DNA-damaging agents ... essential for binding of XRCC1 and Polb to damaged DNAAs PARP -1 is the ﬁrst protein to interact with a nicked AP site during BER, it was interesting to testwhether XRCC1–DNA ligase IIIa and Pol...

Tài liệu Báo cáo khoa học: Epidermal growth factor receptor in relation to tumor development: EGFR gene and cancer ppt

... anextracellular ligand-binding domain; a transmembranedomain; an intracellular tyrosine kinase domain; and a C-terminal regulatory domain [2]. The extracellulardomain is subdivided further into ... threegroups (a) ligands that speciﬁcally bind to EGFR(including EGF, transforming growth factor -a, amphi-regulin and epigen); (b) those that bind to EGFR and ERBB4 (including betacellulin, heparin-binding ... heparin-binding EGF and epiregulin); and (c) neuregulin (NRG) (also knownas heregulin) that binds to ERBB3 and ERBB4.NRG1 and NRG2 bind to both ERBB3 and ERBB4,whereas NRG3 and NRG4 only bind...

Tài liệu Báo cáo khoa học: Epidermal growth factor receptor in relation to tumor development: EGFR-targeted anticancer therapy doc

... epidermal growth factor receptor mutations. BrJ Cancer 95, 998 10 04. 16 Sutani A, Nagai Y, Udagawa K, Uchida Y, KoyamaN, Murayama Y, Tanaka T, Miyazawa H, Nagata M,Kanazawa M et al. (2006) Gefitinib ... 78Yoshida et al. [17 ] Gefitinib 21 91 Sunaga et al. [18 ] Gefitinib 19 76Tamura et al. [19 ] Gefitinib 28 75Sequest et al. [20] Gefitinib 34 55Sugio et al. [ 21] Gefitinib 19 63I. Okamoto EGFR-targeted anticancer ... receptor, thereby inhibiting ligand-dependent EGFR signal transduction; and small-molecule tyrosine kinase inhibitors, such as gefitinib and erlotinib, whichtarget the intracellular tyrosine kinase domain...

Báo cáo khoa học: Epidermal growth factor receptor-regulated miR-125a-5p – a metastatic inhibitor of lung cancer potx

... Collection (Manassas, VA,USA) and maintained in Ham’s F12K medium (Invitrogen,Carlsbad, CA,USA) supplemented with 10 % fetal bovineserum (Shanghai Sangon Biological Engineering Techno-logy and Services ... to regulating migration and invasion,EGFR signaling also in uences proliferation, angiogen-esis, apoptosis, and cell cycle progression [15 ]. Afterfinding that miR -12 5a- 5p negatively regulated ... be bona fide targets ofEGFR signaling (significantly regulated by EGF treat-ment and reversed by gefitinib). Among these candi-dates, miR -12 5a- 5p appeared to be particularlyintriguing, because...

Báo cáo khoa học: Modulation of glucocorticoid receptor-interacting protein 1 (GRIP1) transactivation and co-activation activities through its C-terminal repression and self-association domains pptx

... sequence-dependent 11 22 11 22 14 62 14 625 14 62 14 62 11 21 112 15635635765 In put 10 %Input 1 0% G STGST G ST -G RIP1 13 05 -13 98GST-GRIP1 13 05 -13 98GRIP1GRIP1 1 234596 10 10 11 11 7 12 12 8HA.GRIP1563 -14 62HA.GRIP1563 -14 62HA.GRIP15-765HA.GRIP15-765HA.GRIP15 -11 21 HA.GRIP15 -11 21 HA.GRIP1563 -1 1 21 HA.GRIP1563 -1 ... (5%)HAHA.GRIP15 -14 62GRIP15 -11 21 HA.HA.GRIP1563 -11 21 HA.GRIP1563 -14 62HA.GRIP1 11 22 -14 62HA.GRIP15-765HDAC1.mycHAHA.GRIP1GRIP15 -14 625 -11 21 HA.HA.GRIP1HA.GRIP1HA.GRIP1HA.GRIP1HDAC1.myc563 -11 21 563 -14 62 11 22 -14 625-765++ ... (RLU 10 )Luciferase Activity (RLU 10 )50 1 23 12 0 12 0 16 0 16 01x1x858x858x29000x29000x290x290x 1 59 10 10 AD1AD1 10 13 10 13 11 21 112 1AD1AD1AD2AD2 14 62 14 62 10 13 10 13AD1AD1 11 21 112 1563563[Gal4DBD;...

Báo cáo khoa học: Pleiotropy of leptin receptor signalling is deﬁned by distinct roles of the intracellular tyrosines docx

... cells [6–9].As a class I cytokine receptor, LEPRb activates thejanus kinase ⁄ signal transducer and activator of tran-scription (JAK ⁄ STAT) signalling pathway [10 ,11 ]. Lig- and binding to LEPRb ... residues and appearsto be signalling-inactive [14 ]. Murine LEPRb containsthree intracellular tyrosine residues that are conserved in mammals and birds [15 ,16 ]. Tyr 113 8 is located in a canonical box3 ... signallingcapacity. In particular, our data identify Tyr1077 as a docking site for STAT5.ResultsLeptin receptor signal transduction in HIT-T15 and RINm5F insulinoma cells We used HIT-T15 insulinoma...

Xem thêm