Báo cáo khoa học: MicroRNAs – micro in size but macro in function Sunit K Singh1,2, Manika Pal Bhadra3, Hermann J Girschick2 and Utpal Bhadra4 pptx

Tài liệu Báo cáo khoa học: A DExD⁄ H box RNA helicase is important for K+ deprivation responses and tolerance in Arabidopsis thaliana docx

Tài liệu Báo cáo khoa học: A DExD⁄ H box RNA helicase is important for K+ deprivation responses and tolerance in Arabidopsis thaliana docx

... study, B A 150 100 50 0 –5 0 –1 00 –1 50 –2 00 –2 50 –3 00 –3 50 Time (min) Influx Efflux WT (MS) WT (LK) helps (MS) helps (LK) OE6 (MS) OE6 (LK) 0 1 2345 Net K + flux (pmol⋅cm –2 s –1 ) ⋅ 150 100 50 0 –5 0 –1 00 –1 50 –2 00 –2 50 –3 00 a ab c b a a Efflux ... levels of AKT1, CBL1, CBL9 and CIPK23 in the 2-week-old wide-type, helps m...
Ngày tải lên : 14/02/2014, 18:20
  • 11
  • 786
  • 0
Tài liệu Báo cáo khoa học: MicroRNAs and epigenetics doc

Tài liệu Báo cáo khoa học: MicroRNAs and epigenetics doc

... proto-oncogene and the downstream extracellular signal-regulated kinase 2 (ERK2). J Biol Chem 283 , 1815 8–1 8166. 91 Grady WM, Parkin RK, Mitchell PS, Lee JH, Kim YH, Tsuchiya KD, Washington MK, Paraskeva ... genetic and epi- genetic association study and functional analysis. Cancer Res 69, 597 0–5 977. 90 Kim S, Lee UJ, Kim MN, Lee EJ, Kim JY, Lee MY, Choung S, Kim YJ & Choi...
Ngày tải lên : 14/02/2014, 19:20
  • 12
  • 636
  • 0
Tài liệu Báo cáo khoa học: MicroRNAs and cardiovascular diseases ppt

Tài liệu Báo cáo khoa học: MicroRNAs and cardiovascular diseases ppt

... Herrick SE & Lindsay MA (2010) MicroRNAs and the regulation of fibrosis. FEBS J 277, 201 5–2 021. 15 Wang GK, Zhu JQ, Zhang JT, Li Q, Li Y, He J, Qin YW & Jing Q (2010) Circulating microRNA: ... JD, Yoshino O, Lin S & Han J (2008) Impaired microRNA processing causes corpus luteum insufficiency and infertility in mice. J Clin Invest 118, 194 4–1 954. 20 Giraldez AJ...
Ngày tải lên : 14/02/2014, 19:20
  • 15
  • 684
  • 0
Tài liệu Báo cáo khoa học: Homologous expression of the nrdF gene of Corynebacterium ammoniagenes strain ATCC 6872 generates a manganese-metallocofactor (R2F) and a stable tyrosyl radical (Y•) involved in ribonucleotide reduction ppt

Tài liệu Báo cáo khoa học: Homologous expression of the nrdF gene of Corynebacterium ammoniagenes strain ATCC 6872 generates a manganese-metallocofactor (R2F) and a stable tyrosyl radical (Y•) involved in ribonucleotide reduction ppt

... 62 5–6 33. 52 Stoer J (2005) Stoer, Josef, Bd.1: Numerische Mathema- tik. Springer, Berlin. 53 Heffeter P, Popovic-Bijelic A, Saiko P, Dornetshuber R, Jungwirth U, Voevodskaya N, Biglino D, Jakupec MA, ... Environ Microbiol 60, 75 6–7 59. 16 Wohlleben W, Muth G & Kalinowski J. (1993) Genetic Engineering of Gram-positive bacteria. In Genetic Engi- neering of Microorganisms (Pu ¨ h...
Ngày tải lên : 15/02/2014, 01:20
  • 14
  • 872
  • 0
Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc

Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc

... DIQRHLTHFSLITHGFGTPAICAALSTFQTVLSEMLNYLEKHTTHKNGGAADSGQGHANS .:* *:**.**:**** *:***::::*. : * * ::* . . Alpha N AKSSDKEEKHRK Beta EGP-GSKTGDKEEKHRK Gamma N KTLEKMEKHRK Epsilon K ASEKDAKHRK Delta EKAPLRKTSEAAVKEGKTEKTD ... downre- gulating in ammation and Th1 response. PLoS ONE 2, e1071, doi:10.1371/journal.pone.0001071. 41 Karjalainen JM, Kellokoski JK, Mannermaa AJ, Kujala HE,...
Ngày tải lên : 16/02/2014, 09:20
  • 9
  • 642
  • 0
Tài liệu Báo cáo khoa học: Molecular defect of isovaleryl-CoA dehydrogenase in the skunk mutant of silkworm, Bombyx mori ppt

Tài liệu Báo cáo khoa học: Molecular defect of isovaleryl-CoA dehydrogenase in the skunk mutant of silkworm, Bombyx mori ppt

... silkworm (sku ⁄ + sku ) and the skunk mutant (sku ⁄ sku) at (A) day 2 of fifth instar and (B) 10 days after spinning. Until spinning, the skunk mutant larva develops normally (A). After spinning, ... genes in insect cells. In Inverte- brate Cell System Application (Mitsuhasi J ed), pp. 16 7– 181. CRC Press, Boca Raton, FL. 26 Mita K, Morimyo M, Okano K, Koike Y, Nohata J, Kawa...
Ngày tải lên : 18/02/2014, 04:20
  • 12
  • 631
  • 0
Tài liệu Báo cáo khoa học: Suppressed catalytic efficiency of plasmin in the presence of long-chain fatty acids Identification of kinetic parameters from continuous enzymatic assay with Monte Carlo simulation ppt

Tài liệu Báo cáo khoa học: Suppressed catalytic efficiency of plasmin in the presence of long-chain fatty acids Identification of kinetic parameters from continuous enzymatic assay with Monte Carlo simulation ppt

... K m ¼ k À1 k 2 ðÞ :k 3 k 1 k 2 k 3 ðÞ , k p ¼ k 2 :k 3 k 2 k 3 and the equilibrium associa- tion constant for the product K i ¼ k À3 k 3 . Although the K m and the k p derived for Model I and ... þ K m ð1 þ S 0 K i Þ k p ÁE t0 ln S 0 S 0 À P : ð4Þ It can be proved that t in Eqn (4) is a strictly increasing function of P for any combination of...
Ngày tải lên : 18/02/2014, 17:20
  • 9
  • 473
  • 0
Tài liệu Báo cáo khoa học: Molecular determinants of ligand specificity in family 11 carbohydrate binding modules – an NMR, X-ray crystallography and computational chemistry approach doc

Tài liệu Báo cáo khoa học: Molecular determinants of ligand specificity in family 11 carbohydrate binding modules – an NMR, X-ray crystallography and computational chemistry approach doc

... hydrophobic and polar residues in ligand binding in the family 15 carbohydrate-binding module from Cellvibrio japonicus Xyn10C. Biochemistry 42, 931 6–9 323. 12 Xie HF, Gilbert HJ, Charnock SJ, Davies GJ, ... for screening and identifying ligand binding to protein receptors. Angewandte Chemie-International Edi- tion 42, 86 4–8 90. 16 Mayer M & Meyer B (1999) Characterization o...
Ngày tải lên : 18/02/2014, 17:20
  • 12
  • 687
  • 0
Tài liệu Báo cáo khoa học: Molecular aspects of rheumatoid arthritis: chemokines in the joints of patients pdf

Tài liệu Báo cáo khoa học: Molecular aspects of rheumatoid arthritis: chemokines in the joints of patients pdf

... and IFN-c. (B) Chemokines expressed in the joint recruit leukocytes into the joints. In addition to functioning in cell trafficking, several chemokines have other biological abilities. Chemokines ... Chemokines–chemotactic cytokines that mediate in ammation. N Engl J Med 338, 43 6–4 45. 5 Kelner GS, Kennedy J, Bacon KB, Kleyensteuber S, Largaespada DA, Jenkins NA, Copeland NG, Ba...
Ngày tải lên : 18/02/2014, 18:20
  • 8
  • 652
  • 0
Tài liệu Báo cáo khoa học: Glycation of low-density lipoprotein results in the time-dependent accumulation of cholesteryl esters and apolipoprotein B-100 protein in primary human monocyte-derived macrophages docx

Tài liệu Báo cáo khoa học: Glycation of low-density lipoprotein results in the time-dependent accumulation of cholesteryl esters and apolipoprotein B-100 protein in primary human monocyte-derived macrophages docx

... (2001) Abnormalities in apo B-containing lipoproteins in diabetes and atherosclero- sis. Diabetes Metab Rev 17, 2 7–4 3. 11 Lyons TJ & Jenkins AJ (1997) Lipoprotein glycation and its metabolic ... (1997) Increased accumulation of the glycoxidation product N(epsilon)-(carboxymethyl) lysine in human tissues in diabetes and aging. J Clin Invest 99, 45 7–4 68. 21 Sakata N,...
Ngày tải lên : 19/02/2014, 02:20
  • 12
  • 604
  • 0

Xem thêm

Từ khóa: