Báo cáo khoa học: A novel splicing variant form suppresses the activity of full-length signal transducer and activator of transcription 5A pot
Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx
... 5¢-AAGTAGGCGGAGTATCGAAC-3¢ (sense) and
5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers
for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT
ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT
ACTT-3¢ (antisense).
Caspase 3 activity
Cells ... intensity was determined using imagemaster
2d elite software 4.01 (Amersham Bioscience, Uppsala,
Sweden).
Statistical analysis
Data in bar graphs are expressed as...
Báo cáo khoa học: A novel metallocarboxypeptidase-like enzyme from the marine annelid Sabellastarte magnifica – a step into the invertebrate world of proteases pdf
... granulifera, Cassiopea
xamachana, Condylactys gigantea, Gorgonia ventalina,
Lebrunia danae, Palythoa caribaeorum, Physalia phy-
salis, Plexaura homomalla, Stichodactyla helianthus and
Zoanthus pulchellus); ... and contains more than 25 different variants
Fig. 1. S. magnifica Phylum Annelida, Class Polychaeta, Subclass
Palpata, Order Canalipalpata, Suborder Sabellida, Family Sabellidae,
Gen...
Báo cáo khoa học: A novel 2D-based approach to the discovery of candidate substrates for the metalloendopeptidase meprin pot
... residues, vari-
able oxidation of methionine and variable deamidation of
asparagine and glutamine. Parent and fragment mass toler-
ances were set to 1 Da. Up to two missed cleavages and
half tryptic ... may
speculate that hmeprin has activity similar to BMP-1 ⁄
TLD-like metalloendopeptidases in that it acts as a
procollagen C protease as well as an activator of lysyl
oxida...
Báo cáo khoa học: A novel retinol-binding protein in the retina of the swallowtail butterfly, Papilio xuthus docx
... light adaptation of the eye. Light adaptation also
induced the decrease of all-trans isomer both in the distal
and proximal portions of the retina. In contrast, the increase
of 11-cis ligand was ... using an ATTO AE6905C
Image Saver, and quantified with
NIH IMAGE
program. The
gel was then stained with Coomassie Brilliant Blue, and
the protein content was measured vi...
Báo cáo khoa học: A novel mass spectrometric approach to the analysis of hormonal peptides in extracts of mouse pancreatic islets ppt
... Both end-plate potentials of the ion
trap were set at 1.5 V and the duration of the electron
pulse was 100 ms.
Data acquisition and handling
Primary data analysis was performed on a workstation
running ... ethanol, sonicated
and extracted overnight at +4 °C [23]. After centri-
fugation, the pellet was discarded and a sample of the
supernatant was withdrawn for radi...
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335
E.
coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321
A.
pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... of the FNR (Fig. 5A) . The
Fdx ⁄ CYP17 5A1 ratio was saturated at 8 : 1, and the
turnover rate at an Fdx ⁄ CYP17 5A1 ratio of 8 : 1 was
4.9-fold greater than that at a rat...
Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt
... 8,
459–467.
10 Kanda A, Iwakoshi-Ukena E, Takuwa-Kuroda K &
Minakata H (2003) Isolation and characterization of
novel tachykinins from the posterior salivary gland of
the common octopus Octopus vulgaris. ... in the common octopus (Octopus vulgaris).
Biochem J 387, 85–91.
25 Kanda A, Takahashi T, Satake H & Minakata H (2006)
Molecular and functional characterization...
Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt
... steady-state kinetics of 6-CySeCD
catalysis and investigated the antioxidant ability of
6-CySeCD using a mitochondria injury system.
Results and Discussion
Synthesis and characterization of 6-CySeCD
The ... sulfate ⁄ ascorbate-induced mito-
chondrial damage and the swelling is decreased by
addition of 6-CySeCD.
The absorbance at 520 nm for the control group
was bas...
Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt
... & Brade, H. (1994) Preparation
and structural analysis of oligosaccharide monophosphates
obtained from the lipopolysaccharide of recombinant strains of
Salmonella minnesota and Escherichia ... OX1 is a Gram-negative bacterium
isolated from the activated sludge of a wastewater treatment
plant, and endowed with unusual metabolic capabilities for
the degradation of...
Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc
... [6,8,27] or to
any other sequences available in FASTA and BLAST
database programs at the DNA Data Bank of Jap an.
Recently, we reported the cloning and s equencing of the
gene encoding 4-amino-3-hydroxybenzoate ... release of ammonia, are a key enzyme in
the metabolic pathways of 2-amino phenol and its deriva-
tives. However, little is known about the metabolic steps...
Từ khóa:
- báo cáo khoa học mẫu
- báo cáo khoa học y học
- báo cáo khoa học sinh học
- báo cáo khoa học nông nghiệp
- báo cáo khoa học lâm nghiệp
- báo cáo khoa học thủy sản
- Nghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thống
- Báo cáo quy trình mua hàng CT CP Công Nghệ NPV
- chuyên đề điện xoay chiều theo dạng
- Nghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt nam
- Một số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTP
- Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit
- Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit
- ĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN
- Quản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninh
- Phối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọ
- Phát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninh
- Trả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)
- Phát hiện xâm nhập dựa trên thuật toán k means
- Nghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chế
- Nghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000
- Sở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIX
- BT Tieng anh 6 UNIT 2
- Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vật
- Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật
- Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật