0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Báo cáo khoa học >

Báo cáo khoa học: "Creating a CCGbank and a wide-coverage CCG lexicon for German" pdf

Báo cáo khoa học: Interactions between metals and a-synuclein ) function or artefact? pptx

Báo cáo khoa học: Interactions between metals and a-synuclein ) function or artefact? pptx

... neurodegenerative disorders. J NeurosciRes 58, 120–129.34 Tobe T, Nakajo S, Tanaka A, Mitoya A, Omata K,Nakaya K, Tomita M & Nakamura Y (1992) Cloning and characterization of the cDNA encoding a ... Steavenson S, Jiang Y,Anafi D, Jacobsen FW, Jarosinski MA, Wu GM,Louis JC et al. (2000) Parkinson’s disease-associatedalpha-synuclein is more fibrillogenic than beta- and gamma-synuclein and cannot cross-seed ... to cause disease. These mutationsare associate with early onset of the disease and hasthe pathology includes LBs and is autosomal domin-ant [21]. a- synuclein a- synuclein is a small (14 kDa),...
  • 9
  • 467
  • 0
Báo cáo khoa học: Alternative splicing: good and bad effects of translationally silent substitutions pdf

Báo cáo khoa học: Alternative splicing: good and bad effects of translationally silent substitutions pdf

... codon information, for an amino acid.Translationally silent variations thataffect splicing and diseaseClinical studies identifying aberrant splicing mutationsare of great importance for genetic ... recently an expensive task) and in the underappre-ciated belief that sequence variations far away mayaffect far away splicing signals. With increased aware-ness we predict that this will change ... acquisition of an antagonisticfunction. An explanation for the second category relieson the fact that a weakly tolerated effect on splicingcan be enhanced by additional phenomena such asaffected...
  • 5
  • 437
  • 0
Báo cáo khoa học: Amino acids Thr56 and Thr58 are not essential for elongation factor 2 function in yeast potx

Báo cáo khoa học: Amino acids Thr56 and Thr58 are not essential for elongation factor 2 function in yeast potx

... merolae(BAC67668), Guillardia theta (AAK39722), Parachlorella kessleri(P28996), Chlorella pyrcnoidosa (BAE48222), Beta vulgaris(CAB09900), Arabidopsis thaliana (AAF02837), Oryza sativa(NP_001052057), ... plecoglossi (BAA11470), Ashbya gos-sypii (AAS53513), Candida albicans (CAA70857), Schizosaccharomy-ces pombe (CAB58373), Neurospora crassa (AAK49353), Gibberellazeae (XP_389750), Aspergillus nidulans ... demand [18–21].Unicellular eukaryotes such as yeast appear to lackCaMPKIII [22]. However, yeast eEF2 can serve assubstrate for mammalian CaMPKIII [23]. Donovan and Bodley [23] noted that yeast...
  • 13
  • 424
  • 0
Báo cáo khoa học:

Báo cáo khoa học: "Combining Coherence Models and Machine Translation Evaluation Metrics for Summarization Evaluation" doc

... Text AnalysisConference (TAC). DUC and TAC also manuallyevaluated machine generated summaries by adopt-ing the Pyramid method. Besides evaluating withROUGE/BE and Pyramid, DUC and TAC also askedhuman ... Models and Machine Translation Evaluation Metrics for Summarization EvaluationZiheng Lin†, Chang Liu‡, Hwee Tou Ng‡ and Min-Yen Kan‡†SAP Research, SAP Asia Pte Ltd30 Pasir Panjang Road, ... IntroductionResearch and development on automatic and man-ual evaluation of summarization systems have beenmainly focused on content coverage (Lin and Hovy,2003; Nenkova and Passonneau, 2004; Hovy et al.,2006;...
  • 9
  • 351
  • 0
Tài liệu Báo cáo khoa học:

Tài liệu Báo cáo khoa học: "Creating a manually error-tagged and shallow-parsed learner corpus" pptx

... NorthAmerican Chapter of the ACL, pages 154–162.Joel Tetreault, Elena Filatova, and Martin Chodorow.201 0a. Rethinking grammatical error annotation and evaluation with the Amazon Mechanical Turk. ... Lee and Seneff, 2008; Nagata et al., 2004;Nagata et al., 2005; Nagata et al., 2006; Tetreault etal., 2010b). This is one of the most active researchareas in natural language processing of learner ... head words. In Proc. of Cognition and ExploratoryLearning in Digital Age, pages 184–191.Ryo Nagata, Takahiro Wakana, Fumito Masui, AtsuoKawai, and Naoki Isu. 2005. Detecting article...
  • 10
  • 467
  • 0
Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

... infection, as assessed bythe mitochondrial release of cytochrome c, caspase-9 and caspase-3 activa-tion, and DNA fragmentation. In an in vitro assay, intact ETA inducedADP-ribosylation of EF-2 and ... of ATP, with concomitant generationof ETA and ETA -A fragments. Incubation in theabsence of ATP revealed a small amount of degrada-tion for intact ETA, whereas no degradation wasobserved for ... (h)AEEAFDLWNECAKACVLDLKDGVRSSRMSVDPAIADTNGQGVLHYSMVLEGGNDALKLAIDNALSITSDGLTIRLEGGVEPNKPVRYSYTRQARGSWSLNWLVPIGHEKPSNIKVFIHELNAGNQLSHMSPIYTIEMGDELLAKLARDATFFVRAHESNEMQPTLAISHAGVSVVMAQTQPRREKRWSEWASGKVLCLLDPLDGVYNYLAQQRCNLDDTWEGKIYRVLAGNPAKHDLDIKPTVISHRLHFPEGGSLAALTAHQACHLPLETFTRHRQPR2791ETA-B280GWEQLEQCGYPVQRLVALYLAARLSWNQVDQVIRNALASPGSGGDLGEAIREQPEQARLALTLAAAESERFVRQGTGNDEAGAANADVVSLTCPVAAGECAGPADSGDALLERNYPTGAEFLGDGGDVSFSTRGTQNWTVERLLQAHRQLEERGYVFVGYHGTFLEAAQSIVFGGVRARSQDLDAIWRGFYIAGDPALAYGYAQDQEPDARGRIRNGALLRVYVPRSSLPGFYRTSLTLAAPEAAGEVERLIGHPLPLRLDAITGPEEEGGRLETILGWPETA -A LAERTVVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDYASQPGKPPREDLK613 A BFig....
  • 15
  • 588
  • 0
Tài liệu Báo cáo khoa học: Solution structure of hirsutellin A – new insights into the active site and interacting interfaces of ribotoxins docx

Tài liệu Báo cáo khoa học: Solution structure of hirsutellin A – new insights into the active site and interacting interfaces of ribotoxins docx

... one a- helix, a helical turn and seven b-strands thatform an N-terminal hairpin and an anti-parallel b-sheet, with a characteris-tic a + b fold and a highly positive charged surface. Compared ... delPozo A & Gavilanes JG (2001) RNase U2 and alpha-sarcin: a study of relationships. Meth Enzymol 341,335–351.3 Lacadena J, A ´lvarez-Garcı´ a E, Carreras-Sangra N,Herrero-Gala´n E, Alegre-Cebollada ... extracellularRNase family.ResultsAssignmentThe1H assignments for the backbone and side chainsare nearly complete. The observed conformationalchemical shifts for alpha and amide protons, calculatedas...
  • 10
  • 607
  • 0
Tài liệu Báo cáo khoa học: PC1⁄3, PC2 and PC5⁄6A are targeted to dense core secretory granules by a common mechanism doc

Tài liệu Báo cáo khoa học: PC1⁄3, PC2 and PC5⁄6A are targeted to dense core secretory granules by a common mechanism doc

... compilation ª 2007 FEBSis autocatalytically cleaved, a central catalytic domaincomprising the catalytic triad of amino acids asparticacid, histidine and serine, and a stabilizing P-domaininvolved ... proteases that cleave their substrates at basic amino acids,thereby activating a variety of hormones, growth factors, and viruses.PC1 ⁄ 3, PC2 and PC5 ⁄ 6A are the only members of the PC family ... contains a C-terminal transmembrane domain that retains theenzyme in the Golgi apparatus. The shorter form,PC5 ⁄ 6A, is secreted by both the constitutive and regu-lated secretory pathways. As...
  • 9
  • 600
  • 0
Tài liệu Báo cáo khoa học: Identification, sequencing, and localization of a new carbonic anhydrase transcript from the hydrothermal vent tubeworm Riftia pachyptila docx

Tài liệu Báo cáo khoa học: Identification, sequencing, and localization of a new carbonic anhydrase transcript from the hydrothermal vent tubeworm Riftia pachyptila docx

... GTT ACT TCC GCA GCT AGG 466–483Probe amplification for FISHRpCAbrF TAC AAG GAT GCC ATT AGC 613–630RpCAbrR1 CGT AGC AGT ATC AGC AGT 822–839RpCAtrFprobe TAC AAA GAT CCA ATC CAG C 616–634RpCAtrRprobe ... Strongylocentrotuspurpureus and F. scutaria larvae sequences have a H64 also shared by A. gambiae, A. aegypti, T. gigas,D. melanogaster-2 and D. melanogaster-3 sequences(data not shown). By contrast, R. pachyptila aminoacid ... sequenced RpCAtr (BPNJ¼ 100 and BPMP¼ 99). Fungia scutaria (FCA -a and FCA-b) and Caenorhabditis elegans (CA1 and CA2) sequences falloutside of clade I and are more closely related to eachother...
  • 14
  • 591
  • 0
Tài liệu Báo cáo khoa học: Analysis of proteins and peptides on a chromatographic timescale by electron-transfer dissociation MS ppt

Tài liệu Báo cáo khoa học: Analysis of proteins and peptides on a chromatographic timescale by electron-transfer dissociation MS ppt

... electroninto an amide carbonyl group that is hydrogen bondedto the protonated side chain of a basic amino acid.The resulting radical anion abstracts a proton and gen-erates a radical site that triggers ... to a mass spectrometer equipped for ESI; (c)fragmentation of individual peptides by collision-acti-vated dissociation (CAD); and (d) a search of theresulting tandem mass spectra against a database ... z¢Æ-type fragment ions, and then react-ing them with a second anion that functions as a baserather than an electron donor. The carboxylate anionof benzoic acid satisfies this requirement and deproto-nates...
  • 8
  • 578
  • 0

Xem thêm

Từ khóa: báo cáo khoa họcbáo cáo khoa học mẫubáo cáo khoa học y họcbáo cáo khoa học sinh họcbáo cáo khoa học nông nghiệpbáo cáo khoa học lâm nghiệpbáo cáo khoa học thủy sảnbáo cáo khoa học về cá trabáo cáo khoa học nghiên cứu chôm chômtrạng thái hiện sinh báo cáo khoa họcbiểu tượng văn học báo cáo khoa họctài liệu báo cáo khoa họccách trình bày báo cáo khoa họcbáo cáo khoa học toán họccách làm báo cáo khoa họcchuyên đề điện xoay chiều theo dạngNghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt namNghiên cứu tổ hợp chất chỉ điểm sinh học vWF, VCAM 1, MCP 1, d dimer trong chẩn đoán và tiên lượng nhồi máu não cấpMột số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTPNghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THzđề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giảiGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitPhối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọTrả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Phát triển du lịch bền vững trên cơ sở bảo vệ môi trường tự nhiên vịnh hạ longPhát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngKiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)Quản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtNguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtMÔN TRUYỀN THÔNG MARKETING TÍCH HỢP