Báo cáo khoa học: A DmpA-homologous protein from Pseudomonas sp is a dipeptidase speciﬁc for b-alanyl dipeptides Hidenobu Komeda and Yasuhisa Asano docx

Báo cáo khoa học: A DmpA-homologous protein from Pseudomonas sp. is a dipeptidase speciﬁc for b-alanyl dipeptides Hidenobu Komeda and Yasuhisa Asano docx

... 2005 FEBS A DmpA-homologous protein from Pseudomonas sp. is a dipeptidase speciﬁc for b -alanyl dipeptides Hidenobu Komeda and Yasuhisa Asano Biotechnology Research Center, Toyama Prefectural University, ... L-Ala-(Gly)2(L-Ala)2, L-Ala-D-Ala, L-Ala-D-Ala-L-Ala,DL-Ala-DL-Asn, DL-Ala-DL-Ile, DL-Ala-DL-Leu, DL-Ala-DL-Met, DL-Ala-DL-Phe, DL-Ala-DL-Ser, DL-Ala-DL-Val, L-Asp-D-Ala, L-Pro-Gly, L-Pro-L-Phe, c-Aminobutyryl-L-His ... of BapA and DmpA. The following compounds were not substrates for BapA:(Gly)2(Gly)3, D-Ala-Gly, D-Ala-(Gly)2(D-Ala)2, D-Ala-L-Ala (D-Ala)3(D-Ala)4, L-Ala-Gly, L-Ala-(Gly)2(L-Ala)2,...

Tài liệu Báo cáo khoa học: Cell surface nucleolin on developing muscle is a potential ligand for the axonal receptor protein tyrosine phosphatase-r ppt

... extracellular ligands of the RPTPs inthe neuromuscular system. For example, it is knownthat PTPd and an isoform of LAR can interacthomophilically [39] and that LAR can also bindheterophilically ... black dots, protease cleavage sites. (B) SDS ⁄ PAGEseparation of FN3d–AP puriﬁed from conditioned media using anti-placental alkaline phosphatase (PLAP) agarose. (C) SDS ⁄ PAGE and silverstain ... silverstain of proteins isolated from AP sepharose (lane 1) and FN3d–AP sepharose (lane 2). A protein band of approximately 95 kDa is presentexclusively in the FN3d–AP eluate (arrowhead). (D) Immunoblot...

Báo cáo khoa học: Purine nucleoside phosphorylases from hyperthermophilic Archaea require a CXC motif for stability and folding pot

... phosphorylases from hyperthermophilicArchaea require a CXC motif for stability and foldingGiovanna Cacciapuoti, Iolanda Peluso, Francesca Fuccio and Marina PorcelliDepartment of Biochemistry ... was analyzed by catalyticactivity measurements performed under standard condi-tions.Reactivation assay of SsMTAPII, PfPNP and theirCXC-lacking mutantsThe activity of SsCSC and PfCGC as catalysts ... with apparent Tmvalues of 112 °C and 110 °C, respectively. These enzymes are also character-ized by a remarkable kinetic stability and resistance tomany chemicals, including SDS and guanidinium...

Báo cáo khoa học: The Rieske protein from Paracoccus denitriﬁcans is inserted into the cytoplasmic membrane by the twin-arginine translocase doc

... sequences,the ISP of P. denitriﬁcans was listed as a potential sub-strate for what was later named the Tat pathway [10].To substantiate this assignment, the P. denitriﬁcansISP was initially analysed ... permits substantialISP transport. Comparative sequence analysis reveals characteristics com-mon to Tat signal peptides in several bacterial ISPs; however, there aredistinctive features relating to ... 5¢-CACGGCGCCACCCGGAAGGACTTCCTCTAC-3¢; R15K ⁄ R16K,5¢-GATCACGGCGCCACCAAGAAGGACTTCCTCTACTACG-3¢; Y20K, 5¢-GGAGGGACTTCCTGAAGTACGCGACGGCCGGTG-3¢; C152S, 5¢-GGCGGCTGGTTCAGCCCGTGCCATGG-3¢. For the mutagenesis reactions, a SacI...

Báo cáo khoa học: Antioxidant Dps protein from the thermophilic cyanobacterium Thermosynechococcus elongatus An intrinsically stable cage-like structure endowed with enhanced stability potx

... KazusaDNA Research Institute), using primers Dps-Te1 (5¢-CAAAGGAGACTCATATGAGTGCAACAACTAC-3¢) and Dps-Te2 (5¢-CTACAAAAGCTTAATCCGCAACTAACTGAC-3¢). The NdeI and Hin dIII restriction sites are ... 10761E-mail: andrea.ilari@uniroma1.itDatabaseThe atomic coordinates and structure fac-tors have been deposited in the Protein Data Bank, Research Laboratory for Struc-tural Bioinformatics, ... experiments, and ProfSimonetta Stefanini and Dr Giuliano Bellapadrona for their helpful discussions and valuable suggestions. Wealso thank the beamline scientists of ELETTRA (Bas-ovizza, Trieste, Italy)...

Báo cáo khoa học: Putative prion protein from Fugu (Takifugu rubripes) ppt

... Japanese medaka (Oryz-ias latipes; GenBank: CAL64054), Japanese seabass(Lateolabrax japonicus) and Japanese flounder (Para-lichthys olivaceus) [18] have been described and com-pared (for a ... Boukouvala E, Panagi-otidis CH, Papadopoulos AI, Sklaviadis T & Krey G(2007) Molecular characterization of a cDNA from thegilthead sea bream (Sparus aurata) encoding a fish prion protein. ... Liao M, Zhang Z, Yang G, Sun X, Zou G, Wei Q &Wang D (2005) Cloning and characterization of prion protein coding genes of Japanese seabass (Lateolabraxjaponicus) and Japanese flounder (Paralichthys...

Báo cáo khoa học: "Extracting Noun Phrases from Large-Scale Texts: A Hybrid Approach and Its Automatic Evaluation" pot

... text and calculate recall and precision for a comparison. 7. Applications Identification of noun phrases in texts is useful for many applications. Anaphora resolution (Hirst, 1981) is to ... Extracting Noun Phrases from Large-Scale Texts: A Hybrid Approach and Its Automatic Evaluation Kuang-hua Chen and Hsin-Hsi Chen Department of Computer Science and Information Engineering National ... tagged texts and outputs a linear chunk sequences. We assign a syntactic head and a semantic head to each chunk. Then, we extract the plausible maximal noun phrases according to the information...

Báo cáo khoa học: The signature amidase from Sulfolobus solfataricus belongs to the CX3C subgroup of enzymes cleaving both amides and nitriles Ser195 and Cys145 are predicted to be the active site nucleophiles pot

... 177 A AO55930 PSEDATVVKRLLAAGATVVGKSVCEDLCFSGASFTSASGAVKNPWDLARNAGGSSSGSAV 177 ZP_00124054 PSEDATVVKRLLAAGATVIGKSVCEDLCFSGASFTSATGAVKNPWDLTRNAGGSSSGSAV 177 BAC99079 PSRDATVVTRLLAAGATVAGKAVCEDLCFSGSSFTPASGPVRNPWDPQREAGGSSGGSAA ... ammonia and transformation ofthe planar thioimidate to a planar thiol acyl-enzymethrough a tetrahedral intermediate. Addition of a sec-ond water molecule allows the acid product to leave and ... USA). All other reagentswere from Sigma Aldrich, Carlo Erba (Milan, Italy) orMallinckrodt Baker (Phillipsburg, NJ, USA) and IPTG was from INALCO (Milan, Italy). BCA protein assay KIT and Quanty-cleave...

Báo cáo khoa học: The predominant protein arginine methyltransferase PRMT1 is critical for zebrafish convergence and extension during gastrulation pdf

... PRMT1-mediated argininemethylation of PIAS1 regulates STAT1 signaling. GenesDev 23, 118–132.16 Yamagata K, Daitoku H, Takahashi Y, Namiki K,Hisatake K, Kako K, Mukai H, Kasuya Y & Fukamizu A ... Cheng,Li-Chun Tu and Han-Ni Chuang for ﬁsh rearing,cDNA preparation and WISH probe preparation.References1 Bedford MT & Clarke SG (2009) Protein arginine methyl-ation in mammals: who, what, and why. ... argininemethyltransferase gene family in ﬁsh and ascidians.Gene 340, 179–187.26 Scorilas A, Black MH, Talieri M & Diamandis EP(2000) Genomic organization, physical mapping, and expression analysis...

Báo cáo khoa học: Modeled ligand-protein complexes elucidate the origin of substrate speciﬁcity and provide insight into catalytic mechanisms of phenylalanine hydroxylase and tyrosine hydroxylase pptx

... total electric charge was +6 for 5pah and )16 for 2toh, as 2toh comprises the catalytic core domain and the tetramerization domain. BH4 is uncharged. The aroma-tic amino acids phenylalanine and ... groups. Two alter-native conformations, rotated 180° around an imaginaryiron–catecholamine axis, were found for DA and L-DOPAin PAH and for DA in TH. Electrostatic forces play a keyrole in ... ternary complex of the catalytic domain of humanphenylalanine hydroxylase with tetrahydrobiopterin and 3-(2-thienyl)-L-alanine, and its implications for the mechanism ofcatalysis and substrate...

Xem thêm