Báo cáo khoa học: A novel prokaryotic L-arginine:glycine amidinotransferase is involved in cylindrospermopsin biosynthesis potx
Báo cáo khoa học: A novel prokaryotic L-arginine:glycine amidinotransferase is involved in cylindrospermopsin biosynthesis potx
... that differs from that of the eukaryotic l-arginine:glycine amidinotransferases.AbbreviationsAGAT, human L-arginine:glycine amidinotransferase; AmtA, L-arginine:lysine amidinotransferase; ANS, ... performed using primerscyrA-F (5¢-CATATGCAAACAGAATTGTAAATAGCT-3¢) and cyrA-R (5¢-CTCGAGAATAATGATGAAGCGA-GAAAC-3¢), which incorporated NdeI and XhoI restrictionsites, respectively. The cyrA PCR ... ANS, 8-anilino-naphthalene-1-sulfonate; StrB,L-arginine:inosamine phosphate amidinotransferase; StrB1, Streptomyces griseus L-arginine:inosamine phosphate amidinotransferase. 3844 FEBS Journal 277...
- 17
- 544
- 0
Tài liệu Báo cáo khoa học: A novel c-N-methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1 ppt
... A novel c-N-methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine byArthrobacternicotinovoranspAO1Calin B. Chiribau1, Cristinel Sandu1, ... of naturaland man-made organic compounds, among them thetobacco alkaloid nicotine. Perhaps analysed in greatestdetail is the pathway of nicotine degradation as it takesplace in Arthrobacter ... nicotinovorans; c-N-methylamino-butyrate oxidase; megaplasmid pAO1; nicotine degradation;sarcosine o xidase.The bacterial soil community plays a pivotal role in thebiodegradation of a n a lmost...
- 8
- 647
- 0
Báo cáo khoa học: ISC1-encoded inositol phosphosphingolipid phospholipase C is involved in Na+/Li+ halotolerance of Saccharomyces cerevisiae pptx
... subsequently, its binding to thecalcineurin-dependent response element in a variety ofpromoters including that of ENA1.Asanalternative ,a ceramide-activated phosphatase rather than calcineurinmay be considered ... Salt-stress-dependent induction of ENA1involves the Ca2+/calmodulin-activated protein phospha-tase calcineurin [25], the TOR-GLN3 signalling pathway[27] and possibly also an additional, calcineurin-indepen-dent ... Bielawska, A. , Domae, N., Bell, R.M. & Hannun,Y .A. (1994) Characteristics and partial purification of a novel cytosolic, magnesium-independent, neutral sphingomyelinaseactivated in the early...
- 7
- 239
- 0
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... 277 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... was calibrated using molecularmass standards and equilibrated with buffer A containing150 mm KCl. Gel filtration was carried out with buffer A containing 150 mm KCl at a flow rate of 0.4 mLÆmin)1.Measurement ... thermozeaxanthins andthermobiszeaxanthins, which are the main carotenoidsof T. thermophilus [15]. The insertion of thermozeax-anthins and thermobiszeaxanthins into the cell mem-brane reduces...
- 14
- 617
- 0
Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx
... (sense) and5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primersfor unmethylated DNA were: 5¢-GAAGTAGGTGGAGTATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCTACTT-3¢ (antisense).Caspase 3 activityCells ... Relativefluorescence intensity was determined using imagemaster2d elite software 4.01 (Amersham Bioscience, Uppsala,Sweden).Statistical analysisData in bar graphs are expressed as the mean and standarddeviation ... (OccWT) and variant occludin in apoptosis and invasion, as determined by assay, werevealed that exon 9 played a major role in the induc-tion of mitochondria-mediated apoptosis and thereduction...
- 12
- 613
- 0
Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt
... tachykinins: a review. Zool Sci 5,533–549.7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy-ama M, Minakata H, Chiba T, Metoki H, Satou Y &Satoh N (2004) Tachykinin and tachykinin receptor ... vulgaris).Biochem J 387, 85–91.25 Kanda A, Takahashi T, Satake H & Minakata H (2006)Molecular and functional characterization of a novel gonadotropin-releasing-hormone receptor isolated ... 2239 A novel tachykinin-related peptide receptor of Octopusvulgaris – evolutionary aspects of invertebrate tachykininand tachykinin-related peptideAtsuhiro Kanda, Kyoko Takuwa-Kuroda, Masato Aoyama...
- 11
- 595
- 0
Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt
... CumOOH, and NADPHwere also obtained from Sigma. Sephadex G-25 was pur-chased from Pharmacia (Uppsala, Sweden). All the othermaterials were of analytical grade and obtained fromBeijing Chemical ... reaction mixture at 520 nm.The decrease in absorbance indicated an increase in mito-chondrial swelling and a decrease in mitochondria integrity.TBARS content in ferrous sulfate ⁄ ascorbate-treatedmitochondria ... theconcentration of substrates gave a family of parallellines (Fig. 1), indicating that the reaction mechanism is a ping-pong mechanism. This result demonstrated thatthe GPX mimic, 6-CySeCD, has the...
- 9
- 491
- 0
Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt
... Catania, ItalyPseudomonas stutzeri OXI is a Gram-negative microorgan-ism able to grow in media containing aromatic hydrocar-bons. A novel lipo-oligosaccharide from P. stutzeri OX1was isolated ... & Brade, H. (1994) Preparationand structural analysis of oligosaccharide monophosphatesobtained from the lipopolysaccharide of recombinant strains ofSalmonella minnesota and Escherichia coli ... data matrix was extended to2048 · 1024 points using forward linear prediction extra-polation [28,29].MALDI-TOF analysisMALDI mass spectra were carried out in the negativepolarity in linear...
- 14
- 715
- 0
Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc
... [6,8,27] or toany other sequences available in FASTA and BLASTdatabase programs at the DNA Data Bank of Jap an.Recently, we reported the cloning and s equencing of thegene encoding 4-amino-3-hydroxybenzoate ... 4-amino-3-hydroxybenzoic acid in strain 10d arerevealed.Materials and methodsBacterial strain and growth conditionsBordetella sp. strain 10d was isolated previously [10]. Strain10d w as ... strain JS45 is colorless and does not have anabsorbance peak at 300 nm [5]. A cofactor is not requiredfor t he enzyme activity. In contrast, the deaminase fromstrain 10d contained an FAD-like...
- 7
- 613
- 1
Tài liệu Báo cáo khoa học: "A Novel Feature-based Approach to Chinese Entity Relation Extraction" ppt
... least at current stage. In this paper, we study a feature-based approach that basically integrates entity related information with context information. 3.1 Classification Features The classification ... extraction has been extensively studied in English over the past years. It is typically cast as a classification problem. Existing approaches include feature-based and kernel-based classification. ... incorporated the base phrase chunking information and semi-automatically collected country name list and personal relative trigger word list. Jiang and Zhai (2007) then systematically explored a...
- 4
- 479
- 0
Từ khóa: báo cáo khoa họcbáo cáo khoa học mẫubáo cáo khoa học y họcbáo cáo khoa học sinh họcbáo cáo khoa học nông nghiệpbáo cáo khoa học lâm nghiệpBáo cáo quy trình mua hàng CT CP Công Nghệ NPVNghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt namNghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt namGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANPhối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọPhát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninhNghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000Định tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Tìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tinThơ nôm tứ tuyệt trào phúng hồ xuân hươngKiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtBÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIĐổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namTÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ