Tài liệu Báo cáo Y học: Characterization and regulation of yeast Ca2+-dependent phosphatidylethanolamine-phospholipase D activity docx

... membrane-bound PtdEtn-PLD activity. Cytosolic and membrane-bound fractionswere prepared as described in Materials and methods. PtdEtn-PLD activity measured without addition of EDTA, EGTA and any divalentcations ... characterized the cytosolic and membrane-bound forms of yeast PtdEtn-PLD and examined the regulation of PtdEtn-PLD activity undercertain growth, nutritional and stress conditions.MATERIALS AND METHODSChemicals1-Acyl-2-[6-N-(7-nitrobenzo-2-O-1,3-diazol-4-yl)-amino]-caproyl-glycero-3-phosphorylcholine ... repeated at least twice.Ó FEBS 2002 Characterization and regulation of yeast PtdEtn-PLD activity (Eur. J. Biochem. 269) 3825 Characterization and regulation of yeast Ca2+-dependentphosphatidylethanolamine-phospholipase...

Tài liệu Báo cáo Y học: Presence and regulation of the endocannabinoid system in human dendritic cells potx

... responseplayed by dendritic cells, nothing is known about theircapability to produce, respond to and degrade endocanna-binoids. Indeed as dendritic cells can be derived frommonocytes, and as monocytes ... macrophages and lymphocytes are able to produce a higher amount of anandamide and/ or 2-AG [21,23–26]. IgE-dependent stim-ulation of RBL-2H3 cells also leads to the formation of anandamide and of its ... in-vestigated. Here we have analyzed human dendritic cellsfor the presence of the endocannabinoids, anandamide and 2-arachidonoylglycerol (2-AG), the cannabinoid CB1 and CB2receptors, and one of the...

Tài liệu Báo cáo khoa học: Characterization and mode of action of an exopolygalacturonase from the hyperthermophilic bacterium Thermotoga maritima doc

... into lyases (b-elimination) and hydrolases [2].All hydrolases involved in degradation of pectin areclassiﬁed as members of family 28 of the glycosidehydrolases, including the endopolygalacturonases, ... :(140) FDSRPAFTAAIAACNAAGGGRVVVPAGN WYCAGPIVLLSHVHFHLGADCTIYFSPNPDDYAKDGPVDCGTNGKLYYSRWQS : 182Thther (?) :(192)-SSGTLNTAAIQKAIDKCPD GGVVLVPAGK IFVTGPIHLKSNMTLDVEG TLLGTTDPDQYPNPYDTDPSQVGQ-KSAPLIS ... QAVIVTLSYADNNGTIDYTPAKVPARFYDFTVKNVTVQDSTGSNPAIEITGDSS : 482RsolPehC : RGGYVRDFHVDNV TLPNG VSLTGAGYGSGLLAGSPINSSVPLGVGARTSANPSASQGGLITFDCDYQP-AK : 513Thther : NGGGARNITFRDSALAYITDNDGSPFLLTDGYSSALPTDTSNWAPDEPTFHDITVENCTVNGSK...

Tài liệu Báo cáo khoa học: miRNAs and regulation of cell signaling pptx

... addition, miR-34c is induced under thecontrol of both p53 and p38-MAPK, and preventsMyc-dependent DNA replication by targeting c-Myc[23]. Kawashima et al. [24] reported that brain-derivedneurotrophic ... autoregulatory loop mediated by miR-21 and PDCD4 controls the AP-1 activity in RAS transforma-tion. Oncogene 28, 73–84.65 Klein ME, Lioy DT, Ma L, Impey S, Mandel G &Goodman RH (2007) Homeostatic regulation ... mediates several biological functions by repressingthe indicated targets and presumably hundreds of other as yetunidentiﬁed targets. (B) miR-34a and the miR-34a-binding site inthe 3¢ UTR of...

Tài liệu Báo cáo Y học: Characterization of an omega-class glutathione S-transferase from Schistosoma mansoni with glutaredoxin-like dehydroascorbate reductase and thiol transferase activities pptx

... 0.027-Chloro-4-nitrobenzo-2-oxa-1,3-diazoleNDEthacrynic acid 0.02p-Nitrobenzyl chloride NDVinylene trithiocarbonate NDt-Butyl hydroquinone NDp-Chloranil NDDehydroascorbate 0.20Hydroxyethyl disulfide 0.11Table ... tobind S-hexyl glutathione matrix and displayed significantglutathione-dependent dehydroascorbate reductase and thiol transferase enzymatic activities.Keywords: glutathione S-transferase; dehydroascorbatereductase; ... amplification bands were quantified by usingGelPro and normalized by comparing to a-tubulin ampli-fication products.Enzyme assaysEnzymatic activity towards a range of substrates and inhibitors was determined...

Tài liệu Báo cáo Y học: Expression and characterization of active site mutants of hevamine, a chitinase from the rubber tree Hevea brasiliensis docx

... sufﬁciently high, we decided to refoldthese inclusion bodies.The procedure yielded pure protein as judged by SDS/PAGE. The activity of the pure recombinant protein was80% of that of t he wild-type ... maximum activity at pH 2.0–3.0.Enzyme activity decreases rapidly at pH 5.0 and above.At pH 8.0 and above, there is n o activity remaining. A nTable 2. Statistics of data collection and quality of ... is degraded slowly during the crystallizationTable 3. Relative lysozyme activity of hevamine and hevamine mutantsat pH 5.0. ND, no detectable activity. Hevamine variant Relative activity (%)Wild-type...

Tài liệu Báo cáo Y học: Structural and biochemical characterization of neuronal calretinin domain I– II (residues 1– 100) Comparison to homologous calbindin D28k domain I–II (residues 1 –93) pdf

... fusionproducts. Individual synthetic Calb EF-hands I, III, IVand Vbind calcium [29]. This data of A˚kerfeldt et al. [29] agreeswith the large body of independent data collected on Calb and truncated Calbs ... (h) and other amino acids (.), thecalcium-binding ligands are designated by their coordinates: x, y, z, -y, -x and -z [60]. Residues discussed in the text are given in bold (G34,K60 and G81 of ... preparedin 50 mM deuterated Tris, 25 mM NaCl pH 8.1. Thestimulated-echo with longitudinal eddy current delay(STE-LED) method was applied to obtain diffusion orderedspectroscopy (DOSY) spectra...

Tài liệu Báo cáo Y học: Dnmt3a and Dnmt1 functionally cooperate during de novo methylation of DNA pdf

... cooperation of Dnmt1 and Dnmt3a. PuriﬁedDnmt1 and Dnmt3a enzymes were employed to methylate a958mer PCR product using labeled [methyl-3H]-S-adeno-sylmethionine. We performed a series of three methylationreactions, ... cooperation of Dnmt3a and Dnmt1 in de novomethylation of DNA that can only be provided by in vitroexperiments. In this model Dnmt3a is targeted to a domain of the DNA that is subject to de novo methylation. ... hemimethylated targetsites during DNA methylation [28]. As the activity of Dnmt1 on hemimethylated DNA is much higher [18],generation of one hemimethylated site will immediately leadto a second...

Tài liệu Báo cáo Y học: Characterization of a cloned subtilisin-like serine proteinase from a psychrotrophic Vibrio species doc

... of the catalytic triad are indicated by an asterisk.Secondary structural elements based on knowncrystal structures of PRK are indicated by h(helix) and s (strand) and calcium bindingligands (P175, ... Cys67–Cys99 and Cys163–Cys194 (numbering of VPR from the N-terminal of theproteinase domain (see Fig. 2 or 3). The proteinase domain of VPR additionally contains Cys277 and Cys281, and Cys351 and Cys362 ... proteinase domains of VPR and related enzymes reveals 86 and 71% identity tothe mesophilic proteinases from V. alginolyticus and V. cholerae, respectively, and 60% identity to aqualysin I and the...

Tài liệu Báo cáo Y học: DNA and RNA damage by Cu(II)-amikacin complex docx

... semisynthetic aminoglycoside, aderivative of kanamycin A, having the B1 amino group of 2-deoxystreptamine moiety modiﬁed by acylation with4-amino-2-hydroxybutyric acid. Previous studies demon-strated ... reagents: boricacid, acrylamide, bis-acrylamide and urea were obtainedfrom Serva (Heidelberg, Germany).Decomposition of dG and formation of 8-oxo-dGSolutions of dG (50 lM)in50mMsodium phosphatebuffer, ... the yield of as much as27% of 8-oxo-dG vs. total dG loss at 37 °Candasmuchas53% at 25 °C, indicates a dG-speciﬁc, and thus a relativelymild oxidizing agent. Our study of the mechanism of H2O2activation...

Xem thêm

Từ khóa: tài liệu báo cáo khoa học bản chất của khủng hoảng kinh tế thế giới pdf tài liệu báo cáo nghiên cứu khoa học tai lieu bao cao thuc tap y si da khoa tai lieu bao cao thuc tap tim hieu nhan cach mot hoc sinh báo cáo y học tài liệu báo cáo đề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giải Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit ĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN Phát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninh Trả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Nghiên cứu, xây dựng phần mềm smartscan và ứng dụng trong bảo vệ mạng máy tính chuyên dùng Nghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chế Nghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúng Nghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000 Tìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tin Chuong 2 nhận dạng rui ro Tổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)Kiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)Quản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)Tranh tụng tại phiên tòa hình sự sơ thẩm theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn xét xử của các Tòa án quân sự Quân khu (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vật Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật BÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘI