0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Báo cáo khoa học >

Tài liệu Báo cáo khoa học: "Paraphrasing Using Given and New Information in a Question-Answer System" docx

Tài liệu Báo cáo khoa học:

Tài liệu Báo cáo khoa học: "Paraphrasing Using Given and New Information in a Question-Answer System" docx

... role of given and new information in formulating a paraphrase that differs in a meaningful way from the user's question. A description is also given of the transformational grammar used ... Paraphrasing Using Given and New Information in a Question-Answer System Kathleen R. McKeown Department of Computer and Information Science The Moore School University of Pennsylvania, ... of given information and no clauses defining specific attributes of the missing information. Clauses containing information characterized by category (3) will be presented as separate sentences...
  • 6
  • 532
  • 0
Tài liệu Báo cáo khoa học: ATP-dependent modulation and autophosphorylation of rapeseed 2-Cys peroxiredoxin docx

Tài liệu Báo cáo khoa học: ATP-dependent modulation and autophosphorylation of rapeseed 2-Cys peroxiredoxin docx

... vector] as 5¢-primer and 5¢-TCTCCGTAGGGGAGACAAAAGT-3¢,5¢-ATCCCGCGGGGGAAACCTCATC-3¢ and 5¢-CTGTTTGGACGAACGCAAGATG-3¢as 3¢-primers for C53S, C175S and W88F variants, respec-tively (mutated codons ... peroxiredoxinMartin Aran1, Daniel Caporaletti1, Alejandro M. Senn1, Marı a T. Tellez de In ˜on2, Marı a R. Girotti1,Andrea S. Llera1 and Ricardo A. Wolosiuk11 Instituto Leloir, IIBBA-CONICET, ... Cientı´fi-cas y Te´cnicas (MA, DC, AS and MRG). MTI, ASL and RAW are Established Investigators of the latterinstitution.References1 Toledano MB, Delaunay A, Monceau L & Tacnet F(2004) Microbial...
  • 14
  • 460
  • 0
Tài liệu Báo cáo khoa học:

Tài liệu Báo cáo khoa học: "Hand-held Scanner and Translation Software for non-Native Readers" docx

... printed (ie. off-line)material in foreign languages. It consistsof a hand-held scanner and sophisticatedparsing and translation software to providereaders a limited number of translationsselected ... for all languages.TwicPen has been designed to overcome theseshortcomings and intends to provide readers ofprinted material with the same kind and quality ofterminological help as is available ... (i) a simple hand-heldscanner and (ii) parsing and translation software.TwicPen functions as follows :• The user scans a fragment of text, which canbe as short as one word or as long as a wholesentence...
  • 4
  • 339
  • 0
Tài liệu Báo cáo khoa học:

Tài liệu Báo cáo khoa học: "Integration of Large-Scale Linguistic Resources in a Natural Language Understanding System" pdf

... semantic analysis, and pragmatic analysis. Each stage has been designed to use linguistic data such as the lexicon and grammar, which are maintained separately from the engine, and can easily ... resources into our natural language understanding system. Client- server architecture was used to make a large volume of lexical information and a large knowledge base available to the system at ... Integration of Large-Scale Linguistic Resources in a Natural Language Understanding System Lewis M. Norton, Deborah A. Dahl, Li Li, and Katharine P. Beals Unisys Corporation 2476...
  • 5
  • 416
  • 0
Tài liệu Báo cáo khoa học:

Tài liệu Báo cáo khoa học: "Matching Readers’ Preferences and Reading Skills with Appropriate Web Texts" docx

... retrieval system (Collins-Thompson and Callan, 2004) is based on web data that have beenannotated and indexed off-line. Also, relatedly,(Schwarm and Ostendorf, 2005) use a statisticallanguage ... coherence(e.g.,(Miltsakaki and Kukich, 2004), (Barzilay and Lapata, 2008), (Bruss et al., 2004), (Pitler and Nenkova, 2008)) can also be integrated after psy-cholinguistic evaluation studies are completed and their ... athttp://mallet.cs.umass.edu and Mark Dredze forhis help installing and running MIRA on our data. in Table (2). All classifiers perform reasonablywell in the basic categories classification task butare outperformed...
  • 4
  • 330
  • 0
Tài liệu Báo cáo khoa học:

Tài liệu Báo cáo khoa học: "Extracting Comparative Entities and Predicates from Texts Using Comparative Type Classification" pptx

... types. Mining comparative entities and predicates (Task 2): Our basic idea for the second task is selecting candidates first and finding answers from the candidates later. We regard each of ... defining the syntax and semantics of comparative constructs. Ha (199 9a; 1999b) classified the structures of Korean comparative sentences into several classes and arranged comparison-bearing ... explains how to extract comparative entities and predicates. Our strategy is to first detect Comparative Element candidates (CE-candidates), and then choose the answer among the candidates....
  • 9
  • 405
  • 0
Tài liệu Báo cáo khoa học:

Tài liệu Báo cáo khoa học: "Joint Word Segmentation and POS Tagging using a Single Perceptron" docx

... c11tag t on a word containing char c (not thestarting or ending character)12tag t on a word starting with char c0 and containing char c13tag t on a word ending with char c0 and containing ... incrementally. At eachstage, the incoming character is combined with ex-isting partial candidates in all possible ways to gen-erate new partial candidates. An agenda is used tocontrol the search space, ... of 14.6% in segmentation accuracy and 12.2% in the overall segmentation and tagging accu-racy, compared to the traditional pipeline approach. In addition, the overall results are comparable to...
  • 9
  • 576
  • 0
Tài liệu Báo cáo khoa học: Hypothalamic malonyl-CoA and CPT1c in the treatment of obesity pptx

Tài liệu Báo cáo khoa học: Hypothalamic malonyl-CoA and CPT1c in the treatment of obesity pptx

... increase in malonyl-CoA promotes a decrease in neuropeptide Y and agouti related peptide in hypo-thalamic malonyl-CoA while promoting an increase in proopiomelanocortin and cocaine and amphetamineregulated ... [41–45].There are at least six carnitine acyltransferases in mammals [46]. Carnitine acetyltransferase and carni-tine octonyltransferase mediate the transfer of acetyl and short- to medium-chain fatty acyl-CoAs. ... in various organ systems. Even in organismslacking a brain, such as Caenorhabditis elegans, thenervous system plays a key role in maintaining energybalance [1–4]. In more advanced, mammalian...
  • 7
  • 678
  • 0
Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc

Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc

... was shownthat the broad-complex, tramtrack and bric -a- bracdomain containing protein KCTD1 directly binds toAP- 2a and acts as a negative regulator for AP- 2a trans-activation [34]. It was also ... RRDYHSVRRPDVLLHSAHHG Gamma QQAWPGRQSQEGAGLPSHHGRPAGLLPHLSG-LEAGAVSARRDAY RRSDLLLPHAHAL Epsilon QAAWAAPRAAARAHEE PPGLLAPPARALG-LDP RRDYA TAVPRLLHGLADG Delta IHHGEPTDFINLHNARALKSSCLDEQRRELGCLDAYR RHDLS ... ofAP- 2a- null mice have demonstrated that AP- 2a is a fundamental regulator of mammalian craniofacialdevelopment. AP- 2a knockout mice die perinatallywith craniofacial defects, thoracoabdominoschisis,...
  • 9
  • 642
  • 0
Tài liệu Báo cáo khoa học: X-ray crystallographic and NMR studies of pantothenate synthetase provide insights into the mechanism of homotropic inhibition by pantoate docx

Tài liệu Báo cáo khoa học: X-ray crystallographic and NMR studies of pantothenate synthetase provide insights into the mechanism of homotropic inhibition by pantoate docx

... structure of A. thaliana PS(Fig. S5 and Table S1) shows that it has a large loopat the dimer interface and fewer energetically favorableN-terminal and C-terminal interdomain interactions,such as the ... substrate binding.His106 is involved in intersubunit interactions via itsside chain, and is in a similar position to Glu132 in A. thaliana PS. Val111 and Gly113, on the other hand,are both affected ... Gopalakrishnan B, Aparna V, Jeevan J, Ravi M &Desiraju GR (2005) A virtual screening approach forthymidine monophosphate kinase inhibitors as antitu-bercular agents based on docking and...
  • 16
  • 791
  • 0

Xem thêm

Từ khóa: tài liệu báo cáo khoa học bản chất của khủng hoảng kinh tế thế giới pdftài liệu báo cáo nghiên cứu khoa họctài liệu về báo cáo khoa họcbáo cáo khoa học công nghệ phục vụ nông nghiệp và phát triển nông thôn các tỉnh phía bắc 2006 2007 tài liệu phục vụ hội nghịbáo cáo khoa học tài chính côngbáo cáo khoa học số loài quý hiếm tại vườn quốc gia ba bểtai lieu bao cao thuc tap khoa co khitai lieu bao cao thuc tap tai khoa duoc benh vientai lieu bao cao thuc tap y si da khoabáo cáo khoa học ảnh hưởng của tuổi thu hoạch đến năng suất và chất lượng thức ăn của cỏ voi pennisetum purpureum cỏ ghi nê panicum maximum trồng tại đan phượng hà tây pptxtai lieu bao cao thuc tap tim hieu nhan cach mot hoc sinhbáo cáo khoa học về nghệ thuật trong lieu trai chi ditai lieu bao cao thuc tap tai khoa duoc benh vien hop lucđề tài báo cáo khoa họcđề tài báo cáo khoa học sinh họcNghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thốngNghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoạiNghiên cứu tổ hợp chất chỉ điểm sinh học vWF, VCAM 1, MCP 1, d dimer trong chẩn đoán và tiên lượng nhồi máu não cấpMột số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTPNghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt namđề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giảiGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitNGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDEPhối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọPhát hiện xâm nhập dựa trên thuật toán k meansThơ nôm tứ tuyệt trào phúng hồ xuân hươngChuong 2 nhận dạng rui roTổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)BT Tieng anh 6 UNIT 2Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)Chiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015TÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲQUẢN LÝ VÀ TÁI CHẾ NHỰA Ở HOA KỲ