Tài liệu Báo cáo khoa học: A novel c-N-methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1 ppt

... A novel c-N-methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1 Calin B. Chiribau1, Cristinel Sandu1, ... role in the biodegradation of a n a lmost unlimited spectrum of naturaland man-made organic compounds, among them the tobacco alkaloid nicotine. Perhaps analysed in greatestdetail is the pathway ... to clone the MABO gene. The DNA fragment carrying the MABOORF was ampliﬁed with the primer pair 5¢-GACCTGAGTAGAAATGGATCCCTGA TGGACAGG-3¢and 5¢-GGAATGGCTCGAGGGATCATCACC-3¢ bear-ing the restriction...

Tài liệu Báo cáo khoa học: A facile method for expression and puriﬁcation of the Alzheimer’s disease-associated amyloid b-peptide pdf

... 5¢-GTTCACCACCAGAAGCTGGTGTTCTTC GCTGAA GACGT GGGTTCT AACAAGGGTGCT-3¢;Abc, 5¢-CACAACGCCACCAACCATCAGACCGATGATAGCACCCTTGTTAGAACCCAC-3¢;Ab-start, 5¢-GCGTAGGGTCGACATATGGACGCTGAATTCCGTCACG-3¢;Abstop, ... 5¢-CCTGCCGAGCTCCTATTACACAACGCCACCAACCATCAG-3¢. The PCR solution was prepared in the buffer suppliedwith the enzyme, and contained Aba, Abb and Abcat40 nm each, and the start and stop primers Abstart ... Ab(1–40) and Ab(M1–40) are at least 97%pure. In the lanes containing Ab(1–42) and Ab(M1–42), there were prominent bands at approximately4 kDa and faint bands at approximately 14 kDa. The band at approximately...

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... the synthesis of thermozeaxanthins andthermobiszeaxanthins, which are the main carotenoids of T. thermophilus [15]. The insertion of thermozeax-anthins and thermobiszeaxanthins into the cell ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... summarized in Table 2. The puriﬁed proteinwas analyzed by MALDI-TOF-MS. Peptide mass ﬁn-gerprinting was used to search the NCBInr databaseusing mascot. The result of the mascot searchsuggested that...

Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx

... 5¢-AAGTAGGCGGAGTATCGAAC-3¢ (sense) and5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primersfor unmethylated DNA were: 5¢-GAAGTAGGTGGAGTATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCTACTT-3¢ (antisense).Caspase 3 activityCells ... Relativeﬂuorescence intensity was determined using imagemaster2d elite software 4.01 (Amersham Bioscience, Uppsala,Sweden).Statistical analysisData in bar graphs are expressed as the mean and standarddeviation ... evidence of an additionaloccludin variant deleted in exon 9 (OccDE9). On the basis of a comparative analysis of the involvement of wild-type occludin (OccWT) and variant occludin in apoptosis and...

Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt

... evolutionary aspects of invertebrate tachykininand tachykinin-related peptideAtsuhiro Kanda, Kyoko Takuwa-Kuroda, Masato Aoyama and Honoo SatakeSuntory Institute for Bioorganic Research, Osaka, JapanTachykinins ... into tachykinin-related peptides, their receptors,and invertebrate tachykinins: a review. Zool Sci 5,533–549.7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy-ama M, Minakata H, Chiba T, Metoki ... 8,459–467.10 Kanda A, Iwakoshi-Ukena E, Takuwa-Kuroda K &Minakata H (2003) Isolation and characterization of novel tachykinins from the posterior salivary gland of the common octopus Octopus vulgaris....

Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt

... NADPHwere also obtained from Sigma. Sephadex G-25 was pur-chased from Pharmacia (Uppsala, Sweden). All the othermaterials were of analytical grade and obtained fromBeijing Chemical Plant (Beijing, ... First, the substrate-binding site should match the size andshape of the substrates, and second, incorporation of an imido-group increases the stability of transitionstate selenolate in the catalytic ... (CumOOH) by GSH, indicating that incorporation of the imido-group in the proximity of the selenium atom mayincrease the stability of the nucleophilic intermediateselenolate and enhance GPX-like activity...

Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt

... Thomas-Oates, J.E. & Brade, H. (1994) Preparationand structural analysis of oligosaccharide monophosphatesobtained from the lipopolysaccharide of recombinant strains of Salmonella minnesota ... KOH. The lipo-oligosaccharide was also analyzed after acid treatment,attained by mild hydrolysis with acetic acid, to obtaininformation on the nature of the phosphate and acyl groups. The two ... which links the O-7 of a Hep residue, and a 2-amino-2-deoxy galactose (GalN), which is the branchingpoint of the oligosaccharide. The amino function of the GalNresidue is frequently acylated...

Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc

... [6,8,27] or toany other sequences available in FASTA and BLASTdatabase programs at the DNA Data Bank of Jap an.Recently, we reported the cloning and s equencing of the gene encoding 4-amino-3-hydroxybenzoate ... restingcells of a mutant, strain Y-2, of the aniline-assimilatingPseudomonas sp. strain AW-2 [20].ResultsSpectral changes during metabolism of 4-amino-3-hydroxybenzoic acid by crude extracts of strain ... and2-aminomuconic acid in the modiﬁed meta-cleavage path-way (Fig. 1B). The 2-aminomuconate deaminase from s trainAP-3 and that from strain JS45 have been puriﬁed andcharacterized in detail [5,6]. The nucleotide...

Tài liệu Báo cáo khoa học: "A Novel Feature-based Approach to Chinese Entity Relation Extraction" ppt

... that pattern-based inference is also necessary. The relations of adjacent structure can infer the relations of separated structure if there are certain linguistic indicators in the local context. ... training data (with true entities) where 6 types and 18 subtypes of relations are annotated. We use 75% of it to train SVM classifiers and the remaining to evaluate results. The aim of the ... least at current stage. In this paper, we study a feature-based approach that basically integrates entity related information with context information. 3.1 Classification Features The classification...

Tài liệu Báo cáo khoa học: A novel nuclear DNA helicase with high speciﬁc activity from Pisum sativum catalytically translocates in the 3¢ﬁ5¢ direction docx

... VI)showed a linear rate up to 30 min (Fig. 4A) . After furtherincubation it deviated from the linearity and becamesaturated at  60 min. Titration of helicase activity withincreasing amounts of the ... which catalyse the DNA unwinding in an ATP-dependent manner andthereby act as an essential molecular tool for cellularmachinery [2–6]. All helicases exhibit intrinsic DNA-dependent ATPase activity, ... reactions. The titration curve is plotted as a graph and shown on the left side of the autoradiogram of the gel in Fig. 6B–E. The apparent Kivalues for inhibition by intercalatingagents actinomycin...

Xem thêm

Từ khóa: tài liệu báo cáo khoa học bản chất của khủng hoảng kinh tế thế giới pdf tài liệu báo cáo nghiên cứu khoa học tài liệu về báo cáo khoa học báo cáo khoa học tài chính công báo cáo khoa học số loài quý hiếm tại vườn quốc gia ba bể tai lieu bao cao thuc tap khoa co khi chuyên đề điện xoay chiều theo dạng Nghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt nam Nghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoại Biện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọ Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit ĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN ĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN Quản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninh Phát triển du lịch bền vững trên cơ sở bảo vệ môi trường tự nhiên vịnh hạ long Định tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Thiết kế và chế tạo mô hình biến tần (inverter) cho máy điều hòa không khí Tổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)Kiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật Đổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt nam TÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ QUẢN LÝ VÀ TÁI CHẾ NHỰA Ở HOA KỲ