Tài liệu Báo cáo khoa học: Delineation of exoenzyme S residues that mediate the interaction with 14-3-3 and its biological activity ppt

... analysis it is not obvious how the interaction between 14-3-3 and ExoS occurs,our pull-down analysis with GST-ExoS(LDL426–428AAA) still strongly suggests that ExoS must utilizea strategy for its ... for its interaction with 14-3-3 that is similarto that seen with R18 and serotonin N-acetyltrans-ferase. This is because R18 is also nonphosphorylated and serotonin N-acetyltransferase selectively ... utilizes asubset of residues both in the conserved basic bindinggroove and residues outside the groove [13,28,29]. Tounderstand the molecular basis for why the triplesubstitution mutant ExoS(LDL426–428AAA)...

Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc

... genetic diseases[47].Most analyses of the regulation of AP-2 and the interactions of the transcription factor with bindingpartners, as well as of the regulation of target geneexpression, have ... expres-sion in the face and limbs. In a follow-up study, theyfound that this conserved cis-acting sequence serves tomaintain a level of AP-2a expression that limits the size of the hand plate and ... MLWKLTDNIKYEDC-EDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTBeta MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGPYSSAPPLSHT Gamma MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHT Epsilon MLVHTYSAME RPDGLG-AAAGGARLSSLPQAAYGPAPPLCHT...

Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

... admin-istration of ETA to rats, rapid endocytosis of the intact unprocessed ETA was observed, coincident with the endosomal association of the ETA-A subunit (fastassociation) and low molecular mass ... masses very similar to those seen with the endosomal fractions.We then assessed the major proteolytic cleavagesinduced by cathepsin B and ⁄ or D within the ETAsequence at various pH values ... displayed a molecu-lar mass slightly less than that of the native 66 kDaETA and the unmodiﬁed N-terminal ETA sequence,suggesting the removal of the C-terminal residues of ETA encompassing the...

Tài liệu Báo cáo khoa học: Phosphorylation of cyclin dependent kinase 4 on tyrosine 17 is mediated by Src family kinases pptx

... of the Y17 kinase activity found in HeLa lysates. C-YESis a 62 kDa nonreceptor tyrosine kinase of the Srcfamily that is expressed in a wide range of tissues [24]. The N-terminus of C-YES is ... proce-dures. (B) Recombinant puriﬁed Src family kinases C-YES, C-SRC and LYN were assayed for Y17 kinase activity using the tubeformat assay and western blotting of the samples with the phos-phospeciﬁc ... is thought to be modu-lated by loss of the phosphatase CDC25A. Our datasuggest that Src kinases are candidates to provide the phosphorylation of CDK4. If this is the case, it maybe that Src...

Tài liệu Báo cáo khoa học: Glycation of low-density lipoprotein results in the time-dependent accumulation of cholesteryl esters and apolipoprotein B-100 protein in primary human monocyte-derived macrophages docx

... Australian Postgraduate Awardsadministered through the University of Sydney. The authors thank Professor Roger T. Dean and AssociateProfessor Wendy Jessup for helpful discussions, and Mr Pat Pisansarakit ... cholesteryl esters in the core of the particle from lysosomal esterases, or that impaired lipolysis of LDL lipids may block pro-teolysis of apoB [36]. This may arise as a result of the failure of ... between these twosets of data is not possible, as the extent of other mod-iﬁcations present on these in vivo-modiﬁed particles isnot known. We have suggested that it may be the nat-ure of the...

Tài liệu Báo cáo khoa học: High affinity copper binding by stefin B (cystatin B) and its role in the inhibition of amyloid fibrillation docx

... in the lysosomes and in the cyto-plasm, but also in the nucleus [19]. Lack of expression of stefin B is associated with signs of cerebellar gran-ular cell apoptosis, ataxia and myoclonus as shown ... Comparison of stefin sequences. Shown are the primary amino acid sequences of the three stefin B proteins studied and that of stefin A. The potential copper binding site with four histidine residues is ... differences in intensity and shape between stefins A and B and the P7 9S mutant. The two isoforms of stefin B have exactly the same far UV CD. Regardless of the sequence differences(as highlighted...

Tài liệu Báo cáo khoa học: Binding of ligands originates small perturbations on the microscopic thermodynamic properties of a multicentre redox protein pptx

... Comparison of these results with datafor the isolated cytochrome shows that binding of ligands causes only smallchanges in the reduction potentials of the haems and their pairwise inter-actions, ... signals and perturbing the chemical shifts of the haem methyl sig-nals in intermediate redox stages. The contraction of the line widths of the NMR signals in intermediateredox stages shows that the ... potentials and redox interactionsamong the various centres. Furthermore, because the pH of the samples could be measured inside the NMRtube the values for the redox–Bohr interactions and the macroscopic...

Tài liệu Báo cáo khoa học: Motion of the Ca2+ -pump captured ppt

... detect the shorter form at all with a time resolution of 50 ls. This fact suggests twopossibilities: one is that the lifetime of the smaller formis < 50 ls; another is that SERCA does not ... broken, resulting in‘double membranes’, and these ﬂatten on the mica sur-face with a thickness of  10 nm. Unfortunately, the smallness of the vesicles and their loose adhesion to the mica surface ... 2011)doi:10.1111/j.1742-4658.2011.08222.xStudies of ion pumps, such as ATP synthetase and Ca2+-ATPase, have along history. The crystal structures of several kinds of ion pump have beenresolved, and provide static pictures of...

Tài liệu Báo cáo khoa học: Role of Kupffer cells in pathogenesis of sepsis-induced drug metabolizing dysfunction pptx

... KoreaIntroductionSepsis, severe sepsis and septic shock are worldwideproblems and continue to be the most common causes of death in surgical intensive care units [1]. The patho-genesis of sepsis has often ... hepatic GSH ⁄ GSSGratio during sepsis. Thus, the results of the presentstudy suggest that ROS produced by KCs mediate the sepsis-induced decrease in CYP1A1 and 1A2 activitiespartly through a post-translational ... activities and expressionlevels of various forms of CYP in the liver. In mostcases, CYPs and their activities are suppressed; how-ever, some are unaffected or induced under these con-ditions [18]....

Tài liệu Báo cáo khoa học: Mechanisms of amyloid ﬁbril formation – focus on domain-swapping doc

... suggesting that Pro79 also contrib-utes to the loop rigidity, and its conformation wouldbe strictly trans.These findings are consistent with those of Sanderset al. [155]. On the basis of thermodynamic ... charged side chains within the hydrophobicregion of the edge strand and proline residues bothlimit interactions with other b-pleated sheet edgestrands [79]. It has been suggested that the edgestrands ... drive the assembly of susceptible proteins into amyloid fibrils [19]. The structure of amyloid fibrils reflects the aggregation of strands of b-pleated sheet polypeptides into a longcross-b assembly,...

Xem thêm

Từ khóa: chuyên đề điện xoay chiều theo dạng Nghiên cứu tổ hợp chất chỉ điểm sinh học vWF, VCAM 1, MCP 1, d dimer trong chẩn đoán và tiên lượng nhồi máu não cấp Nghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt nam Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Quản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninh Phối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọ Phát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninh Trả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Nghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chế Nghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000 Thơ nôm tứ tuyệt trào phúng hồ xuân hương BT Tieng anh 6 UNIT 2 Tăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)Tranh tụng tại phiên tòa hình sự sơ thẩm theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn xét xử của các Tòa án quân sự Quân khu (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật Chiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015 HIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀM QUẢN LÝ VÀ TÁI CHẾ NHỰA Ở HOA KỲ