Tài liệu Báo cáo khoa học: Fish and molluscan metallothioneins A structural and functional comparison ppt

Tài liệu Báo cáo khoa học: The nuclear lamina Both a structural framework and a platform for genome organization pdf

... AM, Columbaro M, Scarano G, MattioliE, Sabatelli P, et al. (2005) Alterations of nuclear envel-ope and chromatin organization in mandibuloacral dys-plasia, a rare form of laminopathy. Physiol ... forms inmammals, designated A- type (lamin A and lamin C) and B-type (lamin B1 and lamin B2), in addition to anincreasing number of associated proteins [4]. Laminswere originally isolated from ... thegenome: a marriage made by evolution. Chromosoma114, 212–219.32 Glass CA, Glass JR, Taniura H, Hasel KW, Blevitt JM& Gerace L (1993) The alpha-helical rod domain ofhuman lamins A and C contains...

Tài liệu Báo cáo khoa học: Fish and molluscan metallothioneins A structural and functional comparison ppt

... The Authors. Journal compilation ª 2005 FEBS 6023 Fish and molluscan metallothioneins A structural and functional comparison Laura Vergani1, Myriam Grattarola1, Cristina Borghi2, Francesco ... weadded a BamHI site upstream from the ATG codon, usingthe 5¢-end primer (5¢-CTACTACGAATTAGGATCCCCTGCACCTTG-3¢) and the 3¢-end primer (5¢-GTAATACGACTCACTATAGGGCGAATTGGG-3¢). Ampliﬁcation wasperformed ... On the otherhand, in crab (Scylla serrata and Cancer pagurus) thetwo domains bind three bivalent metals each [20–22].In comparison with mammalians, molluscan MTs usu-ally have higher glycine...

Tài liệu Báo cáo khoa học: Secondary substrate binding strongly affects activity and binding afﬁnity of Bacillus subtilis and Aspergillus niger GH11 xylanases docx

... xylanase mutants with a modiﬁed secondary binding site to water-unextractable arabinoxylan (WU-AX) (A) and oat spelt xylan (OSX) (B) and of A. niger xylanase mutants to water-unextractable arabinoxylan ... X6is a soluble, linear, oligomeric substrate.Xylazyme AX and Azo-wheat AX are polymeric chromo-phoric AX that are water-unextractable and water-extractable, respectively. Water-unextractable AX ... Venkataraman V, SaitHBR, Kasinathan C & Ramasubbu N (2008) Probingthe role of aromatic residues at the secondary saccha-ride-binding sites of human salivary alpha-amylase insubstrate...

Tài liệu Báo cáo khoa học: Amprenavir complexes with HIV-1 protease and its drug-resistant mutants altering hydrophobic clusters docx

... iweber@gsu.edu*Present addressBioscience Division, MS M888, Los AlamosNational Laboratory, Los Alamos, NM, USADatabaseThe atomic coordinates and structurefactors are available in the Protein DataBank with accession ... sidechains of Asp30 and Asp30¢ accommodate diverse functional groups at P2 and P2¢ of SQV and APV atthe surface of the PR active site cavity. The functional group can be critical for a tight ... Atlanta, GA, USA2 Department of Computer Science, Molecular Basis of Disease Program, Georgia State Univers’ity, Atlanta, GA, USA3 Department of Chemistry, Molecular Basis of Disease Program,...

Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

... infection, as assessed bythe mitochondrial release of cytochrome c, caspase-9 and caspase-3 activa-tion, and DNA fragmentation. In an in vitro assay, intact ETA inducedADP-ribosylation of EF-2 and ... (h)AEEAFDLWNECAKACVLDLKDGVRSSRMSVDPAIADTNGQGVLHYSMVLEGGNDALKLAIDNALSITSDGLTIRLEGGVEPNKPVRYSYTRQARGSWSLNWLVPIGHEKPSNIKVFIHELNAGNQLSHMSPIYTIEMGDELLAKLARDATFFVRAHESNEMQPTLAISHAGVSVVMAQTQPRREKRWSEWASGKVLCLLDPLDGVYNYLAQQRCNLDDTWEGKIYRVLAGNPAKHDLDIKPTVISHRLHFPEGGSLAALTAHQACHLPLETFTRHRQPR2791ETA-B280GWEQLEQCGYPVQRLVALYLAARLSWNQVDQVIRNALASPGSGGDLGEAIREQPEQARLALTLAAAESERFVRQGTGNDEAGAANADVVSLTCPVAAGECAGPADSGDALLERNYPTGAEFLGDGGDVSFSTRGTQNWTVERLLQAHRQLEERGYVFVGYHGTFLEAAQSIVFGGVRARSQDLDAIWRGFYIAGDPALAYGYAQDQEPDARGRIRNGALLRVYVPRSSLPGFYRTSLTLAAPEAAGEVERLIGHPLPLRLDAITGPEEEGGRLETILGWPETA -A LAERTVVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDYASQPGKPPREDLK613 A BFig. ... indicate the mobilities of intact ETA ( 66 kDa), ETA -A ( 37 kDa), and unknown degradation fragments. Molecular massmarkers are indicated to the left. ETA and ETA -A signals werequantiﬁed by scanning...

Tài liệu Báo cáo khoa học: Solution structure of hirsutellin A – new insights into the active site and interacting interfaces of ribotoxins docx

... one a- helix, a helical turn and seven b-strands thatform an N-terminal hairpin and an anti-parallel b-sheet, with a characteris-tic a + b fold and a highly positive charged surface. Compared ... delPozo A & Gavilanes JG (2001) RNase U2 and alpha-sarcin: a study of relationships. Meth Enzymol 341,335–351.3 Lacadena J, A ´lvarez-Garcı´ a E, Carreras-Sangra N,Herrero-Gala´n E, Alegre-Cebollada ... SpainFax ⁄ Tel: +34 91 561 94 00E-mail: mbruix@iqfr.csic.esDatabase Structural data has been submitted to theProtein Data Bank and BioMagResBankdatabases under the accession numbers2kaa and...

Tài liệu Báo cáo khoa học: Pyruvate reduces DNA damage during hypoxia and after reoxygenation in hepatocellular carcinoma cells pptx

... NV (2001) Acutehypoxia and hypoxic exercise induce DNA strandbreaks and oxidative DNA damage in humans. FASEBJ 15, 1181–1186.33 Speit G & Hartmann A (2006) The comet assay: a sensi-tive ... antioxidant and redoxpotential regulator that plays a vital role in drugdetoxiﬁcation and in cellular protection againstdamage by free radicals, peroxides, and toxins [13].Hypoxia enhances ... without and with pyruvate(0.8 mm). DNA fragmentation was estimated with thecomet assay. The assay was carried out immediatelyafter the 6 h incubation period, and then 1 and 2 hafter reoxygenation...

Tài liệu Báo cáo khoa học: The stereochemistry of benzo[a]pyrene-2¢-deoxyguanosine adducts affects DNA methylation by SssI and HhaI DNA methyltransferases pptx

... benzo [a] pyrene-2¢-deoxyguanosineadducts affects DNA methylation by SssI and HhaI DNAmethyltransferasesOksana M. Subach1, Diana V. Maltseva1, Anant Shastry2, Alexander Kolbanovskiy2,Saulius Klimasˇauskas3, ... Wyszynski MW, Gabbara S, Kubareva EA, RomanovaEA, Oretskaya TS, Gromova ES, Shabarova ZA &Bhagwat AS (1993) The cysteine conserved amongDNA cytosine methylases is required for methyl trans-fer, ... constant; M.SssI, SssI DNA methyltransferase;M.HhaI, HhaI DNA methyltransferase; MTase, DNA methyltransferase; V0, initial rate of methylation; Vmax, maximal rate of methylation.FEBS Journal...

Tài liệu Báo cáo khoa học: Mechanism of dihydroneopterin aldolase NMR, equilibrium and transient kinetic studies of the Staphylococcus aureus and Escherichia coli enzymes docx

... Restrictionenzymes and T4 ligase were purchased from New EnglandBiolabs (Ipswich, MA, USA). Pfu DNA polymerase and the pET-17b vector were purchased from Stratagene(La Jolla, CA, USA) and Novagen (Madison, ... intermediate as thatof the aldolase reaction and that SaDHNA and EcDHNA have signiﬁcantly different equilibrium and kinetic constants, which form the basis for elucidatingthe catalytic mechanism ... from Staphylococcus aureus (SaDHNA) and its complex with the product HP [8]. In the same year,Haussmann and coworkers demonstrated that theenzyme has both aldolase and epimerase activities and determined...

Tài liệu Báo cáo khoa học: Inhibition of pneumococcal choline-binding proteins and cell growth by esters of bicyclic amines pptx

... same high-afﬁnitybehavior for choline analogs and become saturated at2mm (Fig. 2A) , and agrees with the higher apparentafﬁnity of ipratropium and atropine than of cholinefor C-LytA (Table 1, ... ofC-LytA at 20 °C and pH 7.0, showing two maxima at265 nm and 290 nm. Upon addition of 20 mm choline (a saturating concentration of ligand), two minima at284 nm and 294 nm appear, whereas the ... of Atropa belladonna, and isused as a sympathetic cholinergic blocking drug in pre-medication for anesthesia and in ophthalmology. Onthe other hand, ipratropium is also an anticholinergicagent...

Xem thêm

Từ khóa: Báo cáo quy trình mua hàng CT CP Công Nghệ NPV Nghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoại Nghiên cứu tổ hợp chất chỉ điểm sinh học vWF, VCAM 1, MCP 1, d dimer trong chẩn đoán và tiên lượng nhồi máu não cấp Một số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTP đề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giải Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit ĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN ĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN Phát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninh Phát hiện xâm nhập dựa trên thuật toán k means Nghiên cứu, xây dựng phần mềm smartscan và ứng dụng trong bảo vệ mạng máy tính chuyên dùng Thơ nôm tứ tuyệt trào phúng hồ xuân hương Sở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIX Quản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)Tăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)chuong 1 tong quan quan tri rui ro Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật Chiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015 MÔN TRUYỀN THÔNG MARKETING TÍCH HỢP