Tài liệu Báo cáo " The total specialization of modules over a local ring" ppt
Tài liệu Báo cáo " The total specialization of modules over a local ring" ppt
... Journal of Science, Mathematics - Physics 25 (2009) 39-45 The total specialization of modules over a local ringDao Ngoc Minh∗, Dam Van NhiDepartment of Mathematics, Hanoi National University of ... about the total specializations of modules. We showed that the Cohen-Macaulayness, the Gorensteiness and Buchsbaumness of a module are preserved by the total specializations.2. Specializations of ... specializations of finitely generated modules over a local ring Rpuat an arbitrary associated prime ideal of pα(For specialization of modules, see [3]). Now, we will introduce the notation about...
- 7
- 500
- 1
Tài liệu Báo cáo " The extreme value of local dimension of convolution of the cantor measure" docx
... measure, Adv. in Applied Math., (to appear).[5] P. Shmerkin, ” A modified multifractal formalism for a class of self - similar measures with overlap”, Asian. J.Math., 9 (2005) 323.VNU Journal of ... Mathematics, Vinh University2Department of Fundamental Science, Vietnam academy of Traditional medicineReceived 5 March 2009Abstract. Let µ be the m−fold convolution of the standard Cantor measure ... values in Corollary 1.From Lemma 2, Corollary 3 and Proposition 2, we haveTheorem. Let µ is the 5−fold convolution of the standard Cant or measure, then the lower extremevalue of the loca...
- 12
- 428
- 0
Tài liệu Báo cáo khoa học: Kinetics of dextran-independent a-(1 fi 3)-glucan synthesis by Streptococcus sobrinus glucosyltransferase I pdf
... a glucose analog that is not a substrate of hexokinase in a glucose assay system. The data were analyzed on the basis of the Michaelis–Menten equation; the maximumactivity (kcat) and Michaelis ... resultsfrom the enzymatic activity of the acceptor reaction for the nigerooligo-saccharide with a degree of polymerization of 2–6 and methyl a- D-gluco-pyranoside as a glucose analog indicate that the ... solublenigerooligosaccharides.Table 1. Kinetic parameters of the acceptor reaction. The parameters were obtained by nonlinear least-squares curve-fitting analysis for the data presented in Fig. 4. The kcatand...
- 10
- 661
- 0
Tài liệu Báo cáo khoa học: Synchronization of Ca2+ oscillations: a coupled oscillator-based mechanism in smooth muscle ppt
... Pharmacology, University of Calgary, Alberta, Canada2 School of Biomedical Sciences, University of Newcastle, Callaghan, NSW, AustraliaLong-range signalingBiological organs display coordinated ... coordinated activities thatcan extend over large distances. The spatial extent of signaling required for such long-distance coordinationis many orders of magnitude greater than the size of the participating ... impedance, and hence require a massive amount of current to cause pacemaker depo-larization. On the basis of experimental and theoreticalconsiderations, we now consider how Ca2+oscillationscan...
- 8
- 709
- 0
Tài liệu Báo cáo khoa học: Synchronization of Ca2+ oscillations: a capacitative (AC) electrical coupling model in neuroepithelium pptx
... space,because ICcan pass the plasma membrane capacita-tively. Thus, the current loop can be closed via the extracellular space and the plasma membrane. Thismay allow capacitative electrical ... plasmamembrane, and the cells are tightly packed in the basallayer (Fig. 1C). The voltage fluctuations of the Ca2+store will induce ACs, which can pass the series capaci-tance of the ONM and the plasma ... MINIREVIEWSynchronization of Ca2+oscillations: a capacitative (AC)electrical coupling model in neuroepitheliumMasayuki YamashitaDepartment of Physiology I, Nara Medical University, Kashihara, JapanStructural...
- 7
- 641
- 0
Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc
... ETA -A in the presence of ATP, with concomitant generation of ETA and ETA -A fragments. Incubation in the absence of ATP revealed a small amount of degrada-tion for intact ETA, whereas no degradation ... (h)AEEAFDLWNECAKACVLDLKDGVRSSRMSVDPAIADTNGQGVLHYSMVLEGGNDALKLAIDNALSITSDGLTIRLEGGVEPNKPVRYSYTRQARGSWSLNWLVPIGHEKPSNIKVFIHELNAGNQLSHMSPIYTIEMGDELLAKLARDATFFVRAHESNEMQPTLAISHAGVSVVMAQTQPRREKRWSEWASGKVLCLLDPLDGVYNYLAQQRCNLDDTWEGKIYRVLAGNPAKHDLDIKPTVISHRLHFPEGGSLAALTAHQACHLPLETFTRHRQPR2791ETA-B280GWEQLEQCGYPVQRLVALYLAARLSWNQVDQVIRNALASPGSGGDLGEAIREQPEQARLALTLAAAESERFVRQGTGNDEAGAANADVVSLTCPVAAGECAGPADSGDALLERNYPTGAEFLGDGGDVSFSTRGTQNWTVERLLQAHRQLEERGYVFVGYHGTFLEAAQSIVFGGVRARSQDLDAIWRGFYIAGDPALAYGYAQDQEPDARGRIRNGALLRVYVPRSSLPGFYRTSLTLAAPEAAGEVERLIGHPLPLRLDAITGPEEEGGRLETILGWPETA -A LAERTVVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDYASQPGKPPREDLK613 A BFig. ... postinjection)ABFig. 1. Kinetics of appearance of ETA in hepatic plasma membranes and endosomes after toxin administration. Rat hepatic plasma mem-brane (A) and endosomal fractions (B) were isolated at the...
- 15
- 588
- 0
Tài liệu Báo cáo khoa học: Dissociation of DNA polymerase a-primase complex during meiosis in Coprinus cinereus pptx
... polymerase a- primase complex during meiosisinCoprinus cinereusSatoshi Namekawa, Fumika Hamada, Tomoyuki Sawado†, Satomi Ishii, Takayuki Nara‡, Takashi Ishizaki,Takashi Ohuchi, Takao Arai and ... P-40, and 20% sucrose.DNA primase assayTheDNAprimaseassayusingaDE81filterwasthesameas the DNA polymerase assay except that the RNA primingactivity was monitored by Klenow enzyme (Fig. 5). The assay ... 6. Characterization of C. cinereus DNA polymerase a. (AandB)Western analysis of the active fraction from the MonoQ column usinganti-p140 (A) and anti-p48 Igs. (C) Analysis of the active fraction...
- 10
- 476
- 0
Tài liệu Báo cáo " The meaning and structure of a science fiction story: a sysyemic functional analysis " doc
... declarative declarative declarative declarative declarative declarative declarative declarative declarative declarative declarative declarative declarative declarative declarative ... 18. astronauts 20. astronauts 21. they 13. man 23. the man 26. the man 26. the man anaphoric exophoric cataphoric anaphoric anaphoric anaphoric cataphoric anaphoric anaphoric ... declarative declarative declarative declarative declarative declarative declarative declarative declarative declarative declarative imperative declarative declarative ability/neg....
- 18
- 712
- 4
Tài liệu Báo cáo " The effect of cobalt substitution on structure and magnetic properties of nickel ferrite " pptx
... for a ion Ni2+ and 5 μB for Fe3+. When x increased this leads to the compensation of ion Fe3+ in the tetrahedral and octahedral location. That led to increasing of total magnetization of ... investigate structure and composition variations of the samples. All samples were found to have a cubic spinel structure. TEM was used to study morphological variations. The results indicate that the ... 8NaCl + 22H2O After the precipitation was taken by magnet and the product was washed several time with distilled water. Finally it was annealed in oven at 6000C for 3 hours. 2.2. Measurements...
- 7
- 729
- 0
Tài liệu Báo cáo " The establishment of the Vietnam atomic time scale " docx
... maintaining the national time scale is one of the task which are belong to the national metrology institutes. In order to creating and maintaining a national time scale the time and frequency laboratory ... TA of another station can define local TA using their time difference. 3. Controlling the atomic clock performance As with the national time scales the Vietnam time scale is based on some atomic ... signal ()TAt. Maintaining this signal to trace UTC, we regard this signal as the actual signal of UTC(VMI). Denoting the output of the frequency adjuster as () A ht([as noted, this value...
- 10
- 525
- 0
Từ khóa: tài liệu báo cáo môn triếttài liệu báo cáo tài chínhtài liệu báo cáo môntài liệu báo cáo khoa họctài liệu báo cáo nghiên cứu khoa họctài liệu báo cáo tài chính vốn bằng tiền tai doanh nghiệpNghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoạiNghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THzGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitPhối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọPhát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninhTrả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Nghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngThiết kế và chế tạo mô hình biến tần (inverter) cho máy điều hòa không khíSở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIXTổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)Quản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)Tăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)chuong 1 tong quan quan tri rui roGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtBÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIĐổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namTÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲQUẢN LÝ VÀ TÁI CHẾ NHỰA Ở HOA KỲ