0

β arrestins in endosomal sorting of g protein coupled receptors

Báo cáo y học:

Báo cáo y học: " Signaling and regulation of G protein-coupled receptors in airway smooth muscle" ppsx

Báo cáo khoa học

... discovered RGS (regulators of G protein signaling) proteins [107] Experimental manipulation of RGS protein expression can alter GPCR signaling, but the physiologic role of RGS proteins is unclear Interestingly, ... homologous GPCR desensitization in the airway This may preferentially affect β2 AR signaling in ASM, in light of findings by McGraw et al suggesting that low (endogenous) expression levels of GRKs in ... increased by sloughing of airway epithelium Second, Gq- or Gi -coupled receptor signaling may be sensitized, or Gs -coupled receptor signaling desensitized, resulting in an imbalance of signaling...
  • 23
  • 363
  • 0
Báo cáo khoa học: Methods to monitor the quaternary structure of G protein-coupled receptors doc

Báo cáo khoa học: Methods to monitor the quaternary structure of G protein-coupled receptors doc

Báo cáo khoa học

... higher concentration of G protein provided in the membranes by the : GPCR : G protein stoichiometry of the fusion proteins allowing the G protein fused to one receptor to interact with the G protein ... predominantly in ‘single point’ assays In these, single amounts of Renilla luciferase and fluorescent protein- tagged forms of a single GPCR, to study homodimerization ⁄ oligomerization, or pairs of ... to monitor protein protein interactions in intact living cells both in cell populations and single cells It can be combined with cell imaging and photo-bleaching protocols to examine the cellular...
  • 12
  • 337
  • 0
báo cáo khoa học:

báo cáo khoa học: " Nucleoside conjugates of quantum dots for characterization of G protein-coupled receptors: strategies for immobilizing A2A adenosine receptor agonists" pdf

Báo cáo khoa học

... anchoring moiety for chains containing a single nucleoside moiety The route in Figure utilized an exclusively amide-linked chain, and in Figure an intervening poly(ethyleneglycol) (PEG) spacer group ... 5'-N-ethylcarboxamidoadenosine (NECA) Each tube in the binding assay contained 100 μL of membrane suspension (20 g of protein) , 50 μL of agonist radioligand, and 50 μL of increasing concentrations of the test ligands ... The affinity achieved in the QD conjugate 13 containing the PAMAM dendron linker (Figure 8) was even greater than that of the dendron-nucleoside conjugate 11, suggesting that loss of affinity...
  • 19
  • 194
  • 0
CHARACTERIZATION OF g PROTEIN COUPLED RECEPTORS THROUGH THE USE OF BIO  AND CHEMO  INFORMATICS TOOLS

CHARACTERIZATION OF g PROTEIN COUPLED RECEPTORS THROUGH THE USE OF BIO AND CHEMO INFORMATICS TOOLS

Vật lý

... mouse ORs, greatly limiting our understanding of olfactory coding In 2009, Saito and coworkers, have performed high-throughput screening of 93 odorants against 464 ORs expressed in heterologous cells ... SERVER FOR AUTOMATICALLY HOMOLOGY MODELING AND LIGAND DOCKING Homology modeling is process consisting of main steps: template search, targettemplate sequence alignment, model construction and ... classes of model generation methods have been proposed: (i) Modeling by assembly of rigid bodies; (ii) Modeling by segment matching or coordinate reconstruction; (iii) Modeling by satisfaction of...
  • 7
  • 298
  • 0
Báo cáo khoa học: Activation of nematode G protein GOA-1 by the human muscarinic acetylcholine receptor M2 subtype Functional coupling of G-protein-coupled receptor and G protein originated from evolutionarily distant animals doc

Báo cáo khoa học: Activation of nematode G protein GOA-1 by the human muscarinic acetylcholine receptor M2 subtype Functional coupling of G-protein-coupled receptor and G protein originated from evolutionarily distant animals doc

Báo cáo khoa học

... stage of C elegans as a template with the following primers: M2-goa1-s, 5¢-CATTATAAGA ACATAGGCGCTACAAGGATGGGTTGTACCATGTC ACAGGAAG-3¢; M2-goa1-PstI-as, 5¢-CCAATGCATTGG TTCTGCAGTTAATACAAGCCGCATCCACGAAGA-3¢ ... conditions Human GPCR activates nematode G protein construct, pPAK-M2–Gai1 [25], as a template with the following primers: M2-myc-EcoRI-s, 5¢-CAGAATTCatg gagcagaagctgatctccgaggaggacctgctgGTGAACAACTCCAC ... The increase of GTPcS binding was completely inhibited by Fig Binding of muscarinic ligands All experiments were performed in triplicate Each data point represents the mean ± SEM (A) Binding of...
  • 9
  • 400
  • 0
Báo cáo khoa học: The variable C-terminal extension of G-protein-coupled receptor kinase 6 constitutes an accessorial autoregulatory domain ppt

Báo cáo khoa học: The variable C-terminal extension of G-protein-coupled receptor kinase 6 constitutes an accessorial autoregulatory domain ppt

Báo cáo khoa học

... single incubation at 72 °C for 10 min) using primer P1, 5¢-AGCCCATGGAGCTCGAGAACA TCGTA-3¢ (nucleotides 1–26, sense, initiating ATG underlined) in combination with antisense primers introducing ... (1999) G- protein coupled ¨ receptor kinases as modulators of G- protein signalling J Physiol 517, 5–23 Ferguson SS (2001) Evolving concepts in G proteincoupled receptor endocytosis: the role in receptor ... codon sequence: mGRK6-A M2: P2, 5¢-CTAGTCGC TGGAGTTCCCAGAGGAATCTTGGCG-3¢ (nucleotides 1677–1706, antisense, stop codon underlined) and mGRK6A M3: P3, 5¢-CTAATCTTGGCGACTGAAGAGTCT-3¢ (nucleotides...
  • 13
  • 424
  • 0
Báo cáo khoa học: Allosteric functioning of dimeric class C G-protein-coupled receptors doc

Báo cáo khoa học: Allosteric functioning of dimeric class C G-protein-coupled receptors doc

Báo cáo khoa học

... agonist binding domain and the G- protein coupling domain are part of the same subunit Coupling between ligand binding and HD activation has also been recently examined in the homodimeric mGlu receptors ... receptor, GABA binding in the GABAB1 VFT leading to activation of the GABAB2 HD Although GABAB1 VFT binds the agonist and the GABAB2 HD couples to G- protein, a chimeric construct composed of these ... receptors, the intracellular loops of class C GPCRs as well as the C-terminal tail are involved in G- protein coupling For various class C GPCRs, including the mGlu5, GABAB2 and CaS receptors, the...
  • 9
  • 315
  • 0
Báo cáo khoa học: The impact of G-protein-coupled receptor hetero-oligomerization on function and pharmacology pptx

Báo cáo khoa học: The impact of G-protein-coupled receptor hetero-oligomerization on function and pharmacology pptx

Báo cáo khoa học

... of hetero-oligomers A B H GPCR GPCR H GPCR H H β- arrestin H GPCR H H GPCR GPCR H GPCR GPCR β- arrestin No effect No effect H GPCR H GPCR H GPCR β- arrestin β- arrestin H GPCR β- arrestin ERK activation ... cartoon showing the hypothetical mechanisms of receptor–b-arrestin interaction and ERK1 ⁄ signaling is shown in Fig Regardless of the mechanism by which b -arrestins bind to GPCRs, the signaling pathway ... chemokine CCR2b and CCR5 receptors that gained coupling selectivity for G1 1 -protein in cotransfected HEK-293 cells [14]; (c) dopamine D1 and D2 receptors that gained coupling selectivity for Gq-proteins...
  • 8
  • 488
  • 0
Báo cáo khoa học: The study of G-protein coupled receptor oligomerization with computational modeling and bioinformatics doc

Báo cáo khoa học: The study of G-protein coupled receptor oligomerization with computational modeling and bioinformatics doc

Báo cáo khoa học

... Domain swapping in G- protein coupled receptor dimers Prot Eng 11, 1181–1193 Gouldson PR, Higgs C, Smith RE, Dean MK, Gkoutos GV & Reynolds CA (2000) Dimerization and domain swapping in G- protein- coupled ... reasonable insights into the structural and functional features of the aminergic receptors Among them, 16 of 33 locations that are known to be involved in ligand binding in aminergic receptors ... compensated by changes in the interacting protein (Fig 2C) to preserve the protein protein interface In the hypothetical multiple sequence alignment shown in Fig 2, these compensatory changes occur at...
  • 13
  • 515
  • 0
Báo cáo khoa học: Identification of sites of phosphorylation by G-protein-coupled receptor kinase 2 in b-tubulin ppt

Báo cáo khoa học: Identification of sites of phosphorylation by G-protein-coupled receptor kinase 2 in b-tubulin ppt

Báo cáo khoa học

... Kameyama, K., Haga, K., Haga, T., Moro, O & Sadee, W (1994) Activation of a GTP-binding protein and a GTP-binding-proteincoupled receptor kinase (b-adrenergic-receptor kinase-1) by a muscarinic receptor ... fusion proteins of full-length bI-tubulin, bIII-tubulin, and C-terminal peptides of bI-tubulin expressed in E coli We cloned the bI-tubulin and bIII-tubulin genes GST fusion proteins of bI-tubulin ... suggested to mediate the internalization of b-adrenergic receptors [45] The GRK-mediated phosphorylation of tubulin may affect physiological processes including GPCRs, and the interaction of GRK2...
  • 10
  • 267
  • 0
Báo cáo sinh học:

Báo cáo sinh học: " Kaposi''''s sarcoma associated herpesvirus G-protein coupled receptor activation of cyclooxygenase-2 in vascular endothelial ce" pptx

Hóa học - Dầu khí

... tumorigenesis, leading to significant retardation in tumor growth [33] Whether induction of COX-2 leads to the angiogenic and tumorigenic effects of vGPCR is currently under investigation Increased ... selective COX-1 inhibitor SC560 had no significant effect on PGE2 secretion of vGPCRexpressing HUVEC (Fig 5B) These results demonstrate that the increased production of PGE2 in vGPCR-expressing HUVEC ... features of carcinogenesis including mutagenesis, mitogenesis, angiogenesis, metastasis, inhibition of apoptosis and immunosuppression [29] KS lesions are characterized by increased levels of PGE2...
  • 9
  • 458
  • 0
Báo cáo hóa học:

Báo cáo hóa học: " Kaposi''''s sarcoma associated herpesvirus G-protein coupled receptor activation of cyclooxygenase-2 in vascular endothelial cells" ppt

Hóa học - Dầu khí

... tumorigenesis, leading to significant retardation in tumor growth [33] Whether induction of COX-2 leads to the angiogenic and tumorigenic effects of vGPCR is currently under investigation Increased ... selective COX-1 inhibitor SC560 had no significant effect on PGE2 secretion of vGPCRexpressing HUVEC (Fig 5B) These results demonstrate that the increased production of PGE2 in vGPCR-expressing HUVEC ... features of carcinogenesis including mutagenesis, mitogenesis, angiogenesis, metastasis, inhibition of apoptosis and immunosuppression [29] KS lesions are characterized by increased levels of PGE2...
  • 9
  • 327
  • 0
Báo cáo khoa học: G protein-coupled receptor-induced Akt activity in cellular proliferation and apoptosis pptx

Báo cáo khoa học: G protein-coupled receptor-induced Akt activity in cellular proliferation and apoptosis pptx

Báo cáo khoa học

... Murga C, Laguinge L, Wetzker R, Cuadrado A & Gutkind JS (1998) Activation of Akt ⁄ protein kinase B by G protein- coupled receptors A role for a and bc subunits of heterotrimeric G proteins acting ... G- protein bc-dimers in growth and differentiation Oncogene 20, 1653–1660 20 Murga C, Fukuhara S & Gutkind JS (2000) A novel role for phosphatidylinositol 3-kinase b in signaling from G protein- coupled ... receptor tyrosine kinases and G protein- coupled receptors Neurosignals 15, 217–227 Wu EH & Wong YH (2006) Activation of muscarinic M4 receptor augments NGF-induced pro-survival Akt signaling in PC12...
  • 12
  • 392
  • 0
Báo cáo khoa học: G protein-coupled receptor 30 down-regulates cofactor expression and interferes with the transcriptional activity of glucocorticoid pdf

Báo cáo khoa học: G protein-coupled receptor 30 down-regulates cofactor expression and interferes with the transcriptional activity of glucocorticoid pdf

Báo cáo khoa học

... following primers were used for cloning at the pLEGFP-N1 vector: GPR30-forward 5¢-TAATAAGTCGACGGGTC TCTTCCT-3¢ and GPR30-reverse 5¢-ATTATTGGATC CTACACGGCACTGC-3¢ Viruses capable of introducing pLEGFP-N1, ... t-test as indicated in Fig C, control GPR30 C TIF-2 C GPR30 Fig GPR30 down-regulates the expression of TIF2 protein The regulation of cofactor was studied in HME cells stably expressing GPR30 The ... suggesting the antiproliferative activity of GPRs [21–23] The role of GPR30 in glucocorticoid-mediated signaling has not hitherto been described Many groups independently demonstrated GPR30 in...
  • 10
  • 389
  • 0
Báo cáo Y học: Progestin upregulates G-protein-coupled receptor 30 in breast cancer cells pot

Báo cáo Y học: Progestin upregulates G-protein-coupled receptor 30 in breast cancer cells pot

Báo cáo khoa học

... used for PCR: GPR30-forward, 5¢-AGTCGG ATGTGAGGTTCAG-3¢; GPR30-reverse, 5¢-TCTGTGT GAGGAGTGCAAG-3¢; TBP-forward, 5¢-TTTGGAAG AGCAACAAAGG-3¢; TBP-reverse, 5¢-AAGGGTGCAG TTGTGAGAG-3¢ TBP was used ... associated with the beginning of growth inhibition by progestins GPR30 mRNA is regulated according to the dose of progestin, which also correlated with progestin-induced growth inhibition More importantly, ... (***) highly significant RESULTS Cloning of genes, the expression of which is altered during progestin-induced growth inhibition To study genes associated with progestin-induced growth inhibition,...
  • 6
  • 425
  • 0
Báo cáo y học:

Báo cáo y học: "Novel G-protein-coupled receptor-like proteins in the plant pathogenic fungus Magnaporthe grisea" pot

Báo cáo khoa học

... TPIAESIAVYVFGALIYASKIPERWYPGCFDYFGGSHNLWHLAVLGGIVFHYIAMQE GLSASGFLPIFQIWLTRGGMSVWEHY SPILESLFVYFLGALVYASKVPERWCPGMFDYVGGSHNLWHMAVLGGILFHYNAMQE GLGASLFLPLAHGLSVLGWKRLDAAMGLESFLGLAAINFSGSAVYAMRIPERWFPGTFDLIGQSHNWMHVLVLTGALVRLNGLIR ... EFSFWGQIYGYLSAILYLGSRLPQLLLNFRRKSTEGVSMLFFLFACLGNLTYVLSILAYDGS -SECAAGPGDCEDGEPGQ -EFNILGQVFGWLCAVLYLGSRVPQILLNYRRKSTEGVSMLFFLFACLGNLTYVLSIFAFEPRCRDKHSGIGPHAGGCVGGEAGR SQEPQAVIGMILGYFSAVCYLCARIPQIIKNYREKSCEGLALLFFLLSLTGNLTYGASVIAY ... GLGASLFLPLAHGLSVLGWKRLDAAMGLESFLGLAAINFSGSAVYAMRIPERWFPGTFDLIGQSHNWMHVLVLTGALVRLNGLIR GLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSN GLGLSGVVPVVHAVGEDGFAALDERMGLKWVMLQGAMYIFGAFIYAARWPERSFPGKFDIWCSSHQIFHIFVLLAAASHLYGMIK...
  • 14
  • 242
  • 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 1

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 1

Cao đẳng - Đại học

... subunit GAP Guanosine triphosphatase activating proteins GDP Guanosine diphosphate GEF Guanine-nucleotide exchange factors GIRK G protein- coupled inwardly rectifying potassium G protein Guanine nucleotide ... regulator of G protein signaling (RGS), leads to the replacement of GTP with GDP and reassociation of G with G γ heterodimer, leading to the termination of G protein- mediated signaling (Figure 3) ... Desensitization of G protein Signaling 1.2.3.1 The discovery of Regulator of G protein signaling (RGS) Studies of the desensitization of G- protein- coupled signal transduction have led to the discovery of...
  • 220
  • 228
  • 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 2

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 2

Cao đẳng - Đại học

... 466 QQDRSHIQQFPGCQVFQPTKHAIYHMTSKGKDMINGSVPRGRASEGDATHSATHRHG-VA QQDRAYTAQYPGSQLFQPTKHSIYQITPNGKDLINGMNSRGRTSDAESTPRDHKPNEKLP QEDKGYPQPDASIVVFQPSKYAIYGITERGQRVCG -WIARDKSRETFYDNRGMP LIDSKHCDKKSNTSTSKNNIVKTIDSALMKQANECLEMAYHIYSSYIMIGSPYQLNIHHN ... HPH1 RGS1 Figure 21 A rgs1D WT Rgs1 OP Complemented B WT rgs1D Complemented Rgs1 OP _ Figure 22 Inductive Non-inductive _ Figure 23 WT rgs1D Complemented Figure 24 Figure 25 Figure 26 Rgs1 MG00990 ... ESPRNTMQLVNLERDTETDKLSHDRATIEVIFRRFAGQDGPNVKSSISTSDSDSLSDYSN FQISRSSFFTLSKRGWDLVSWTGCKSNNIRAPNGSTIDLDFTLRGHMTVRDEKKTLDDSE Rgs1 Cprgs-1 FlbA Sst2 408 213 420 406 GLTGVKMAPERKVNGKIHKDTFTGK-AASEWLMDCCTTVDRREAVEIASLFVEYELIEAL GLTGVKMAAERKIGGKTYKETFTGK-AATDWLMDCSTTVDRRETVEIASYFVEFGLMECV...
  • 12
  • 185
  • 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 3

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 3

Cao đẳng - Đại học

... Figure 28 Inductive Non-inductive _ Figure 29 Figure 30 Inductive Non-inductive _ Figure 31 B A Figure 32 A B Figure 33 A B Figure 34 mgb1D WT _ rgs1Dmgb1D magB G1 83Smgb1D Figure 35 Figure ... mgb1D WT _ rgs1Dmgb1D magB G1 83Smgb1D Figure 35 Figure 36 MG010315 MG010105 MG09134 Control: Gamma actin MG03982 MG01173 MG01630 Figure 37 A B ...
  • 11
  • 227
  • 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 4

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 4

Cao đẳng - Đại học

... Figure 39 WT rgs1D Figure 40 Figure 41 Figure 42 _ Figure 43 - Gd + Gd, 1h + Gd, 0h + Gd, 2h + Gd, 0.5h + Gd, 3h _ Figure 44 A WT rgs1D Solvent Solvent 10mM 8-Br-cAMP 10mM 8-Br-cAMP _ B WT rgs1D ... Solvent 10mM 8-Br-cAMP 10mM 8-Br-cAMP _ B WT rgs1D Figure 45 Appressorium formation on inductive membrane (%) Appressorium formation on Noninductive membrane (%) WT 89 1.5 mscL∆ 92 mscS1∆ 87 2.5...
  • 9
  • 180
  • 0

Xem thêm