đánh giá về tình hình đầu tƣ trực tiếp của nhật bản vào việt nam trong bối cảnh hình thành vjepa

Báo cáo khoa học: " Uncoupling GP1 and GP2 expression in the Lassa virus glycoprotein complex: implications for GP1 ectodomain shedding" ppt

Ngày tải lên : 12/08/2014, 04:21

... detection in the unbound fraction (Figure 3A, lane 5) Analysis of the eluate fraction revealed two strong protein bands, a 36-kDa sGP2 monomer and a larger species ca 72-kDa in size (Figure 3A, lane ... GPCTM-FLAG revealed a 38-kDa sGP2 species (Figure 3B, lane 7), and in the eluate fraction, two strong proteins were detected, a 38-kDa sGP2 monomer and a larger species ca 76-kDa in size (Figure ... the unbound fraction (Figure 3B, lanes and 8) The eluates from both GPC variants revealed very strong bands ca 76-kDa and 78-kDa in size, for GPCTMIC-FLAG and GPCTM-FLAG, respectively (Figure...

17
332
0

Lecture 3 DNA RNA and protein synthesis great

Ngày tải lên : 13/03/2014, 16:36

...  A polymer {a compound made of repeating subunits}   WHAT DOES “DNA” STAND FOR? DNA’s proper name isDeoxyribonucleic acid!  Consists of a ribose SUGAR with a “missing oxygen” (that’s the de-oxy...

17
671
2

Tài liệu Báo cáo khoa học: Template requirements and binding of hepatitis C virus NS5B polymerase during in vitro RNA synthesis from the 3¢-end of virus minus-strand RNA docx

Ngày tải lên : 20/02/2014, 01:20

... Nucleotides are numbered increasingly from the 3¢-end of the RNA; the five first stem-loops (A) are named as reported by Schuster et al [13] The 228 nt of domain I fold into five stable stem-loops ... are shown (A) Domain I is composed by 228 nt located at the 3¢ end The first five stem loops are named as described in [13] (B) Secondary structure of a fragment spanning from nt 229–365 in domain ... observed between the wild-type (–)IRES and the (–)IRES 20 RNAs (data not shown) These results strongly suggest that multiple domains of the 341 nt of the minusstrand RNA 3¢-end are involved in...

15
597
0

Báo cáo khoa học: Molecular cloning and characterization of the crustacean hyperglycemic hormone cDNA from Litopenaeus schmitti Functional analysis by double-stranded RNA interference technique pot

Ngày tải lên : 23/03/2014, 10:20

... eyestalk CHHs of penaeid shrimps such as Penaeus monodon (80%), M ensis (77%) and Litopenaeus vannamei (73%) (Fig 1A) The deduced amino acid sequence of the obtained cDNA corresponded to the one ... cDNA reported for Marsupenaeus japonicus (AB035724), Metapenaeus ensis (AF109775), Litopeneaus vannamei (AY434016), Peneaus monodon (AF104930) and CHH nucleotide sequence obtained from Litopeneaus ... of hyperglycemic and molt-inhibiting activity from sinus glands of the penaeid shrimp Penaeus vannamei Gen Comp Endocrinol 103, 41–53 Spanings-Pierrot C, Soyez D, Van Herp F, Gompel M, Skaret G,...

9
486
0

Báo cáo khoa học: De novo RNA synthesis by a recombinant classical swine fever virus RNA-dependent RNA polymerase pot

Ngày tải lên : 30/03/2014, 20:20

... stunt virus, cucumber necrosis virus [38] and hepatitis C virus [39] Taken together, these results strongly suggest that the puriﬁed CSFV NS5BD24 could preferentially initiate either plus- or minus-strand...

10
471
0

cdna preparation and characterization

Ngày tải lên : 10/04/2014, 11:12

... C o n t r i b u t o r s to V o l u m e 3 Article numbers are in parentheses following the names of contributors Affiliations listed are current CHRISTOPHER ASTON (4), Department of Chemistry, ... Chemistry, W M Keck Laboratory for Biomolecular Imaging, New York University, New York, New York 10003 NAMADEV BASKARAN(3, 16), Genome Therapeutics Corporation, Waltham, Massachusetts 02453 ALASTAIR ... that begin by an initial cDNA synthesis step and can be used to amplify m R N A from single cells, namely, reverse transcriptasepolymerase chain reaction (RT-PCR) 6-8 and antisense R N A (aRNA) amplificationY...

588
178
0

Báo cáo sinh học: " Nucleocapsid formation and RNA synthesis of Marburg virus is dependent on two coiled coil motifs in the nucleoprotein" pot

Ngày tải lên : 18/06/2014, 18:20

... was cloned in frame with a mutant of Ebola virus VP30 (MFlag; Fig 2A, [14]) The fusion protein, named C1C2MFlag, was coexpressed with the N-terminus of NP (NP∆441–695), which contains the two ... 315GVNVGEQYQQLREAAHDAEVKLQRRHEHQEIQAIAEDDEERKILEQFHLQKTEITHSQTLAVLSQKREKLARLAAEIENNIVEDQG400 EBOV NP V Y QL A A QL L I 333GVNVGEQYQQLREAATEAEKQLQQYAESRELDHLGLDDQEKKILMNFHQKKNEISFQQTNAMVTLRKERLAKLTEAITAASLPKTS418 Figure to 367 coil motif in Zaire Ebola virus NP (A) In silico analysis...

8
393
0

Báo cáo sinh học: " Stimulation of poliovirus RNA synthesis and virus maturation in a HeLa cell-free in vitro translation-RNA replication system by viral protein 3CDpro" docx

Ngày tải lên : 19/06/2014, 08:20

... but only VP0 was present in the 80S peak fractions of the gradient (Fig 4C) 3CDpro(3CproH40A) strongly enhances the production of mature viral particles As we discussed above, the extra 3CDpro(3CproH40A) ... [30] In addition, recent studies of genetically modified 3CDpro polypeptides in RNA replication strongly support a role of 3CDpro/3CDpro complexes, mediated by 3Dpol domain contacts [50] Whether ... visualized by autoradiography The reaction products were quantitated with a Phosphorimager (Molecular Dynamics Storm 800) by measuring the amount the amount of [α-32P]CMP incorporated into RNA Alternatively,...

19
489
0

Báo cáo hóa học: " Nucleocapsid formation and RNA synthesis of Marburg virus is dependent on two coiled coil motifs in the nucleoprotein" pdf

Ngày tải lên : 20/06/2014, 01:20

... was cloned in frame with a mutant of Ebola virus VP30 (MFlag; Fig 2A, [14]) The fusion protein, named C1C2MFlag, was coexpressed with the N-terminus of NP (NP∆441–695), which contains the two ... 315GVNVGEQYQQLREAAHDAEVKLQRRHEHQEIQAIAEDDEERKILEQFHLQKTEITHSQTLAVLSQKREKLARLAAEIENNIVEDQG400 EBOV NP V Y QL A A QL L I 333GVNVGEQYQQLREAATEAEKQLQQYAESRELDHLGLDDQEKKILMNFHQKKNEISFQQTNAMVTLRKERLAKLTEAITAASLPKTS418 Figure to 367 coil motif in Zaire Ebola virus NP (A) In silico analysis...

8
379
0

Báo cáo hóa học: "Preparation and characterization of carbon nanofluid by a plasma arc nanoparticles synthesis system" pot

Ngày tải lên : 21/06/2014, 04:20

... horizontal mesh heat pipe Energy Conv Manag 2011, 52:292 Kulkarni DP, Namburu PK, Bargar HE, Das DK: Convective heat transfer and fluid dynamic characteristics of SiO2-ethylene glycol/water nanofluid ... http://www.nanoscalereslett.com/content/6/1/293 Page of 11 Table List of fabrication parameters and properties for carbon/water nanofluid Name NC-70 NC-80 Working currents (A) 70 80 Working voltage (V) 24.3~24.7 26.2~26.8 Working power...

11
554
0

Báo cáo hóa học: " Intermatrix synthesis: easy technique permitting preparation of polymer-stabilized nanoparticles with desired composition and structure" ppt

Ngày tải lên : 21/06/2014, 04:20

6
324
0

Báo cáo khoa học: "Vegetative propagation of oak (Quercus robur and Q petraea) by cutting and tissue culture" pot

Ngày tải lên : 08/08/2014, 19:21

... in vitro rooting contained no cytokinin and had a lower level of mineral salts Cytokinins are strong inhibitors of adventitious rooting, and high-salt media had indirect inhibitory effects GD...

13
234
0

Báo cáo sinh học: "Therapeutic dendritic cell vaccine preparation using tumor RNA transfection: A promising approach for the treatment of prostate cancer" pps

Ngày tải lên : 14/08/2014, 19:22

... with dendritic cells for prostate cancer Int J Cancer 2007, 121(3):467-73 Boczkowski D, Nair SK, Nam JH, Lyerly HK, Gilboa E: Dendritic cells pulsed with RNA are potent antigen-presenting cells...

7
363
0

Tổng hợp este metyl antranilat trên cơ sở đó pha chế một số đơn hương dùng cho mỹ phẩm = Synthesis of methylanthranilate and preparation of some flavours used in comestics on its basis

Ngày tải lên : 13/03/2015, 10:11

4
530
0

Cambridge.University.Press.The.Crisis.of.Literature.in.the.1790s.Print.Culture.and.the.Public.Sphere.Nov.1999.pdf

Ngày tải lên : 21/09/2012, 11:00

... suppose the two ﬁrst persons you would choose to see’, writes Hazlitt, ‘would be the two greatest names in English literature, Sir Isaac Newton and Mr Locke.’ Williams’s point is that if ‘the use ... ideal helped to legitimate The hopes and anxieties generated by this communicative ideal have strong parallels with responses to ‘the information revolution’ in our own age Although rooted in ... But it also forces us to recognize the extent to which the social formation within which these dynamics operated was characterized by overlapping points of consensus and difference It was wholly...

316
972
2

Cambridge.University.Press.War.Land.on.the.Eastern.Front.Culture.National.Identity.and.German.Occupation.in.World.War.I.May.2000.pdf

Ngày tải lên : 21/09/2012, 11:02

... German administration, this study uses German names given to the locations under occupation to reXect and trace those ambitions, providing current names as needed (while obviously in no way endorsing ... the German side, naming the battle was a task of great symbolic signiWcance Afterwards, LudendorV explained that rather than choosing one of the small locales with unmelodious names, ‘‘at my suggestion, ... Everywhere were people whose surnames were messes of ethnicity (or living testimony to the accretion of history and identity, depending on one’s view) Even so, surnames were not reliable indicators...

320
957
3

IELTS Writing Preparation

Ngày tải lên : 04/10/2012, 09:39

... damages culture It promotes the stronger cultures of countries such as Britain and North America and weakens the cultures of less wealthy countries This is because the stronger, wealthier countries ... the charts, the answer does accurately reflect the content of the graphic material and gives a strong impression of the trend of change in the education of women which is the main point of the...

45
1.4K
8

food preparation is easy

Ngày tải lên : 04/10/2012, 10:24

1
532
0

modern tech creates single culture

Ngày tải lên : 04/10/2012, 10:24

1
559
1

Preparation And Practice

Ngày tải lên : 08/10/2012, 09:06

102
578
1