two and three dimensional flows
Lightweight Electric/Hybrid Vehicle Design ppt
... study of FEA for EVs and structural analysis assemblies Running gear design for optimum performance and lightweight Lightweight vehicle suspension Handling and steering Traction and braking systems ... chapters In Part Two, John Fenton, in his first two chapters, uses his recent experience as a technology writer to review past and present EV design package trends, and in his second two chapters ... body-structure and chassis-systems He returned to industry for a short period, as a technology communicator, first Product Affairs Manager for Leyland Truck and Bus, then technical copywriter and sales...
- 280
- 555
- 0
Lightweight Electric/Hybrid Vehicle Design docx
... study of FEA for EVs and structural analysis assemblies Running gear design for optimum performance and lightweight Lightweight vehicle suspension Handling and steering Traction and braking systems ... chapters In Part Two, John Fenton, in his first two chapters, uses his recent experience as a technology writer to review past and present EV design package trends, and in his second two chapters ... body-structure and chassis-systems He returned to industry for a short period, as a technology communicator, first Product Affairs Manager for Leyland Truck and Bus, then technical copywriter and sales...
- 280
- 434
- 0
Lightweight Electric/Hybrid Vehicle Design pptx
... study of FEA for EVs and structural analysis assemblies Running gear design for optimum performance and lightweight Lightweight vehicle suspension Handling and steering Traction and braking systems ... chapters In Part Two, John Fenton, in his first two chapters, uses his recent experience as a technology writer to review past and present EV design package trends, and in his second two chapters ... body-structure and chassis-systems He returned to industry for a short period, as a technology communicator, first Product Affairs Manager for Leyland Truck and Bus, then technical copywriter and sales...
- 280
- 333
- 0
Lightweight Electric/Hybrid Vehicle Design Ron ppt
... study of FEA for EVs and structural analysis assemblies Running gear design for optimum performance and lightweight Lightweight vehicle suspension Handling and steering Traction and braking systems ... chapters In Part Two, John Fenton, in his first two chapters, uses his recent experience as a technology writer to review past and present EV design package trends, and in his second two chapters ... body-structure and chassis-systems He returned to industry for a short period, as a technology communicator, first Product Affairs Manager for Leyland Truck and Bus, then technical copywriter and sales...
- 280
- 492
- 0
Báo cáo khoa học: Isolation, characterization and expression analysis of a hypoxia-responsive glucose transporter gene from the grass carp, Ctenopharyngodon idellus potx
... GLUT1 and GLUT3 (exons 3–8), and four in human GLUT2 (exons 7–10) and GLUT4 (exons 6–9) (Table 1) The codons for arginine (96) and valine (231) in gcGLUT (Fig 2) are split between exons and 5, and ... (between exon and exon 5) and valine (between exons and exon 7) are shown Exonic regions are shown in uppercase and intronic regions are in lowercase The split codons are boxed and highlighted ... was inferred by 5¢-RACE and the two alternate 3¢-ends of exon 12 were deduced by 3¢-RACE, and are delineated by the full-length cDNA clones, GT-cDNA1 and GT-cDNA The two putative polyadenylation...
- 8
- 465
- 0
Báo cáo Y học: Heterologous expression and folding analysis of a b-tubulin isotype from the Antarctic ciliate Euplotes focardii ppt
... b-tubulin sequences for Euplotes species (accession numbers P20365 and Q08115, and S Pucciarelli and C Miceli, unpublished results) and three vertebrate tubulins (including human b5) (Fig 4), revealed ... respectively), and mapped on tubulin secondary ` structure as determined by Inclan and Nogales [47] Arrows and rectangles indicate b-sheets and a-helices, respectively The labels ÔLÕ and ÔMÕ indicate ... lane 1) and of CCT purified from rabbit reticulocyte lysate (2 lg and lg in lanes and 3, respectively) Lanes and were Western blotted and immunostained by an anti-(TCP-1a) polyclonal Ig Lane was Coomassie...
- 7
- 500
- 0
DELIVERING HEALTH EDUCATION VIA THE WEB: DESIGN AND FORMATIVE EVALUATION OF A DISCOURSE-BASED LEARNING ENVIRONMENT pot
... considering past practices and experiences of the subject lecturer; reviewing HIV/AIDS and nutrition teaching resource kits; and, identifying and reviewing Web sites related to HIV/AIDS and nutrition ASCILITE ... readability of text, appropriateness of graphics and icons, clarity and quality of information, suitability of external links, and clarity and perceived motivating and discussion promoting characteristics ... unobtrusive background and simple, recognisable graphics and icons and readable text in terms of font type and size Reviewers felt that the navigational icons were representative and few technical...
- 12
- 411
- 0
Báo cáo hóa học: " Research Article Design and Experimental Evaluation of a Vehicular Network Based on NEMO and MANET" pdf
... network, the number y of HAs serving the mobile network and the number z of MNPs (Mobile Network Prefixes) advertised in the mobile network In this paper, we focus on the “single MR, single HA and ... tunnel SFR 3G IPv4 network IPv6 over IPv4 tunnel Inria IPv6 network (France) HA1 Irisa IPv6 network (France) HA2 IEEE 802.11b managed mode Infrastructure network Vehicle network 3G IEEE 802.11b ... the global network performance This simultaneous usage of NEMO and MANET has been experimentally evaluated within our testbed Vehicular Network Design and Testbed Architecture Our network architecture...
- 18
- 596
- 0
Báo cáo hóa học: " Research Article Design and Performance Analysis of an Adaptive Receiver for Multicarrier DS-CDMA" doc
... rectangular pulse waveform with unit amplitude and duration τ, ωq and φq are the frequency and random phase of the qth subcarrier, respectively, and c(k) (t) is the spreading sequence of user ... Synchronisation, Standards and Networking, John Wiley & Sons, New York, NY, USA, 2003 [2] L.-L Yang and L Hanzo, “Multicarrier DS-CDMA: a multiple access scheme for ubiquitous broadband wireless communications,” ... second moment and βq (t) is uniformly distributed (k) over and 2π It is assumed that the channel gain ζq (t) is independent and identically distributed (i.i.d.) for different values of k and q This...
- 10
- 436
- 0
Báo cáo nghiên cứu khoa học: " EXPERIMENTAL AND THEORETICAL ANALYSIS OF A CRITICAL CHEMICAL REACTION: DECOMPOSITION OF HYDROGEN PEROXIDE (H2O2)" potx
... there is no change in kinetics and potential energies, and that all heat fluxes and the shaft work are zero except for the heat fluxes respective to the reaction and to the cooling d (ρVr H ) ... experiments and was 0.0045 This value was almost 12.5 times higher than the value of kwirges For experiments and 6, the mean value was 0.000707 and it was times higher than kwirges Experiments and were ... solution with hydrogen peroxide and ferrous ions is known as Fenton’s reagent and is used for the initiation of polymerizations, hydroxylation of aromatic derivatives and oxidative couplings, among...
- 9
- 463
- 0
Báo cáo y học: "ptimized design and data analysis of tag-based cytosine methylation assays" pps
... contributions MS and JMG designed the assays and strategies for its analysis, MS performed all library preparation and characterization, MS, DL and MP performed bisulfite validation studies, while QJ and ... strengths of MSCC and HELP-seq/Methylseq, and the supporting analytical workflow that maximizes the quantitative capabilities of the data generated Results and discussion Library preparation and sequencing ... this sequence and plotted the starting positions of this sequence within the reads obtained We observed that approximately twothirds of the reads contained the expected sequence, and found that...
- 11
- 345
- 0
Báo cáo y học: " Chemical fingerprinting and quantitative analysis of a Panax notoginseng preparation using HPLC-UV and HPLC-MS" pdf
... 3) Additional file 3: PDA Chromatograms standard compounds (A) and a XST injection (C), and total ion current chromatograms of standard compounds (B) and a XST injection (D) 1-27 were the characteristic ... file 5, 6, 7, and 9) Ten saponins, namely R1, ginsenoside Rg1, Re, Rb1, Rg2, Rh1, Rb2, Rd, 20(S)-Rg3 and 20(R)-Rg3 were quantitatively determined and the rest 17 saponins without standard references ... performed the fingerprint and quantitative analysis and wrote the manuscript PYS and QS assisted HY to identify the characteristic peaks using HPLC-PDA/ESI-MSn All authors read and approved the final...
- 8
- 471
- 0
Design and control methodology of a lower extremity assistive device
... (LEAD), is developed and presented Next, we proposed and justified the need for two different assistance controllers, namely gravity compensation and gait period based assistance, for two different ... plane joint angles, moments and powers for the hip and knee during level walking Shown are average values (solid line), one standard deviation in average value (gray band), and average foot off (vertical ... motion state based on joint angles and ground reaction force (GRF) information [29] They have shown it effectiveness in sit-to-stand and standto-sit transfers [29], and in supporting walking [30]...
- 118
- 425
- 1
Design and performance analysis of efficient wireless systems
... path) is expressed as the harmonic mean of two exponential random variables These two exponential random variables denote the SNRs of the source-relay and the relay-destination links, respectively ... it is easy to understand that for the same packet, its CSIT and CSIR are different, or say, decorrelated due to the delay This is a practical and general model for the design and performance analysis ... ABEP-based and the BEOP-based power control laws for the imperfect CSI case For both the ABEP-based and the BEOP-based power control laws, we derive explicit ABEP and BEOP results under perfect CSI and...
- 195
- 377
- 0
Design and performance analysis of quadratic form receivers for fading channels
... channel and is a weighted sum of norm squares and cross terms of two correlated, complex Gaussian random variables [24–29] It applies to various detections if different values are set for the three ... channel index, and the Gaussian random variables have zero means and CHAPTER INTRODUCTION channel-independent variances and covariances The probability density function (PDF) and the characteristic ... 15 and a = 194 5.8 Differences between Qm (a, b) and its bounds Qm±0.5 (a, b) versus b for a = 1, 5, 10 and m = 5, 10, 15 195 The generalized Marcum Q-function Qm (a, b) and...
- 291
- 1,298
- 0
Design and performance analysis of MIMO space time block coding systems over general fading channels
... process and forward the received signals at the relay The most common strategies are amplify -and- forward (AF) and decode -and- forward (DF) Other strategies include compress -and- forward (CF) and selection ... communication, especially in the last decade Consequently, the demand for bandwidth and capacity becomes more and more urgent, and the fading problem has never been so critical The capacity of ... allocation and the equal power allocation, with η = 90% and ζ = 80%, 70%, 50% and 0%, respectively 2.9 40 43 Case I: BEP results for the conventional and the optimum SBS receivers, 2Tx and 2Rx...
- 162
- 272
- 0
Identification, characterization and expression analysis of a novel TPA (12 0 tetradecanoylphorbol 13 acetate) induced gene
... adenocarcinomas overexpress EGF-family ligands (such as transforming growth factor-α (TGF-α) and EGF) and receptors (EGFR, ERBB2 or Her2/neu, and ERBB3) (36,38,41) EGFR and ERBB2 induction occurs in low-grade ... localization and function of this gene 3) Clone the promoter of this gene and understand the basal transcriptional regulation of its expression 34 MATERIALS AND METHODS 3.1 MICROARRAY AND IDENTIFICATION ... 1.2.6 Expressed Sequence Tags (ESTs) and SAGE 1.3 Biology of PKC and TPA 1.3.1 Cell Growth and Tumour Promotion 1.3.2 PKCs and Pancreatic Cancer 1.4 Biology of Transmembrane/...
- 118
- 501
- 0
NATIONAL REPORT OF MALAYSIA ON THE FORMULATION OF A TRANSBOUNDARY DIAGNOSTIC ANALYSIS AND PRELIMINARY FRAMEWORK OF A STRATEGIC ACTION PROGRAMME FOR THE BAY OF BENGAL potx
... of South-East Asia and occupies a total land area of 330,434 square kilometres The land mass comprises three main components: Peninsular Malaysia and the two states of Sabah and Sarawak, which ... 1985, and Exclusive Economic Zone Act, 1984), vessel operation and conduct (The Merchant Shipping Ordinance, 1952), land use pattern (National Land Code, 1965, and Land Conservation Act, 1960), and ... alluvial tin and sand, caused widespread degradation of areas with mineral deposits leaving behind sandy, barren and unfertile land, unattended water bodies, and silted waterways Landslips, particularly...
- 88
- 581
- 0
Báo cáo khoa học: Staphylococcus aureus elongation factor G – structure and analysis of a target for fusidic acid pdf
... helices AV and BV at the surface of domain V Gly621 and Gly617 are in the area of contact with the 1095 and 2473 regions of 23S RNA The two helices are facing the ribosome, and the four-stranded b-sheet ... II and III, the only physical connection between domains G and II and domains III, IV and V In the S aureus EF-G structure, this loop has a bent conformation, and packs against domain III and ... factor and EF-G As in other GTPases, domain G contains a conserved P-loop, which coordinates the a-phosphate and b-phosphate, and two so-called switch regions, which coordinate the c-phosphate and...
- 15
- 474
- 0
Báo cáo khoa học: Functional analysis of a murine monoclonal antibody against the repetitive region of the fibronectin-binding adhesins fibronectin-binding protein A and fibronectin-binding protein B from Staphylococcus aureus pot
... fibronectin (Fn), and use these as a bridge between the bacterial surface and host cell receptors [12] S aureus MSCRAMMs that bind to collagen, Fn and fibrinogen have been identified and characterized ... form in body fluids and in an insoluble, fibrillar form in the extracellular matrix Its main functions include cell adhesion and spreading, regulation of cell shape and migration, and differentiation ... and functional features of the Fn-binding moieties of FnBPA and FnBPB NYQFGGHNSVDFEEDTLPQVSGHNEGQQTIEEDTTP High-affinity binding sites for full-length Fn and its N-terminal fragment in FnBPA and...
- 16
- 560
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các nguyên tắc biên soạn khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến tốc độ rôto n fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha chỉ tiêu chất lượng 9 tr 25