0

tuples lists and functions in f and c

Tài liệu Use Variables and Functions in T-SQL pptx

Tài liệu Use Variables and Functions in T-SQL pptx

Cơ sở dữ liệu

... DateDiff() function As with Visual Basic's DateDiff() function, this function takes two dates, and based on the interval requested, it returns the difference between the two To check out other functions ... you can also use functions to perform some of the tasks needed, just as you within Visual Basic Not all of the functions are the same, nor are there necessarily as many For instance, instead of ... dgResults Add the code in Listing 6.2 to the Load event of the form (Double-click on the form to bring up the code.) Creating the T-SQL routine described in the "Technique" section, this code then assigns...
  • 4
  • 548
  • 0
Báo cáo khoa học: Plant DNA polymerase k, a DNA repair enzyme that functions in plant meristematic and meiotic tissues docx

Báo cáo khoa học: Plant DNA polymerase k, a DNA repair enzyme that functions in plant meristematic and meiotic tissues docx

Báo cáo khoa học

... oligonucleotide is 5¢-AGCTACCATGCCT GCACGAAGAGTGCGTATTATGCCTACACTGGA GTACCGGAGCATCGTCGTGACTGGGAAAAC-3¢ [3H]dTTP (10 lM; 10 CiÆmmol)1) and enzymes were added as indicated in the figure legends, and incubated ... sequences are 5¢-ACTGGAGATCTGC AT-3¢ and 5¢-TGAAGCATGCAGATCTCCAGT-3¢ Misincorporation assay The four template/primer structures used, which differ only in the first template base, are shown in Fig ... superfamily of conserved domains in DNA damage-responsive cell cycle checkpoint proteins FASEB J 11, 68–76 Bertocci, B., De Smet, A., Flatter, E., Dahan, A., Bories, J .C. , Landreau, C. , Weill, J.C...
  • 9
  • 492
  • 0
Báo cáo khoa học: Two types of replication protein A in seed plants Characterization of their functions in vitro and in vivo ppt

Báo cáo khoa học: Two types of replication protein A in seed plants Characterization of their functions in vitro and in vivo ppt

Báo cáo khoa học

... CTCTTCTGGTAACGA) The three-step cycling conditions were: 29 PCR cycles for AtRPA70b (F1 -R1), 35 cycles for AtRPA70b (F2 -R2), and 25 cycles for S16, at 94 C for 30 s, 55 C for 30 s, and 72 C for A ... (AA CAGTCATCTTCACTCTTTGT); AtRPA70b-5¢ (TTCAA CTTTGTACCCATTGAT) and AtRPA70b-3¢ (TTCACCG CCATTATATACCTTA) These primers were used to obtain a fragment of 722 bp corresponding to nt 1135– 1857 of ... Six-histidine fusion proteins of OsRPA70a and OsRPA70b were present in the inclusion body fraction, so cell pellets were subjected to three rounds of resuspension in binding buffer, sonication, and centrifugation...
  • 12
  • 588
  • 0
Muscle Functions in Polymyalgia Rheumatica and Giant-Cell Arteritis docx

Muscle Functions in Polymyalgia Rheumatica and Giant-Cell Arteritis docx

Sức khỏe người cao tuổi

... 1.1% and 0.7% for total fat, bone and muscle mass, respectively Healthy Aging & Clinical Care in the Elderly 2010:2 Muscle functions in PMR and GCA Table Characteristics of polymyalgia rheumatica ... requently occur together, have unknown causes and have different clinical manifestations.1,2 Inflammatory processes both in vessels and in ­ onnective c t ­issue can cause a wide variation of clinical ... diminished physical activity and impaired muscle function.5 Long-lasting corticosteroid treatment is often necessary, particularly for GCA, which can further accelerate the loss of bone and muscle tissues.6...
  • 8
  • 265
  • 0
Báo cáo khoa học: Making sense of G-quadruplex and i-motif functions in oncogene promoters pot

Báo cáo khoa học: Making sense of G-quadruplex and i-motif functions in oncogene promoters pot

Báo cáo khoa học

... CGC CCC GC CC -3′ 6.4 GC CC AAAA CC CC CC -3′ 5.9 Rb: 5′- CC 5.8 3′ 5′ 3′ 3′ 5′ 5′ RET VEGF Class II N6/8 c- Myc: 5´- CCC Rb N2/5 CCC CACCTT CCC CA Bcl-2: 5´- CCC GCTCCCGC CCCC TTCCT CCC 3′ Transitional ... Journal compilation ª 2010 FEBS T A Brooks et al G-quadruplex and i-motif in oncogene promoters Class I N2 N3/4 Transitional pH N2 VEGF: 5′- CCC GC CCC CGG CCC GC CCC -3′ RET: 5′- CCC GC CC CGC CCC ... 6.6 GCGCCCG CCCC -3′ 6.6 TCCCCA CCC 3′ 5′ c- Myc Bcl-2 Fig Sequences and folding patterns of i-motifs in the two proposed classes of i-motifs found in eukaryotic promoter elements Class I, having...
  • 11
  • 366
  • 0
Báo cáo khoa học:

Báo cáo khoa học: "Tuples, Discontinuity, and Gapping in Categorial Grammar" pdf

Báo cáo khoa học

... any account of gapping must solve, categorisation of the right hand conjunct and access of the verbal semantics in the left hand conjunct, it attempts to so within a narrow conception of categorial ... Derivation for 'for whom John works' both blocking ordinary application, and licensing coordination with a left hand conjunct of the same category The blocking is necessary because 'and Charles, ... The full prosodically and semantically labelled logic is given in Figure In TL lc and 2c pick out the first and second projections of the prosodic object c in the same way that projections pick...
  • 10
  • 392
  • 0
Báo cáo khoa học: Gene duplication and separation of functions in aB-crystallin from zebrafish (Danio rerio) pptx

Báo cáo khoa học: Gene duplication and separation of functions in aB-crystallin from zebrafish (Danio rerio) pptx

Báo cáo khoa học

... duplication in zebrafish aB-crystallin ZaB2 ZaB1 HaB CaB 1 1 ********* MDIAINPP-FRRILFPIFFPR RQFGEHITEADVIS -SL -YSQ MEISIQHPWYRRPLFPGFFPYRIFDQYFGEHLSDSDPFSPFYTM -FYY MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLR ... proteins Similar subfunctionalization in zebrafish genes after duplication has been identified in cellular retinoic acid-binding proteins [23] Separation of functions after gene duplication also occurred ... span intron ⁄ exon boundaries to avoid amplification of genomic DNA: sense 5¢-GCCGAC GTGATCTCCTCATT-3¢; antisense 5¢-CCAACAGGGA CACGGTATTT-3¢ Cycle parameters were: 94 C for 15 s, 55 C for 30...
  • 10
  • 372
  • 0
Báo cáo sinh học:

Báo cáo sinh học: " The herpes simplex virus UL20 protein functions in glycoprotein K (gK) intracellular transport and virus-induced cell fusion are independent of UL20 functions in cytoplasmic virion envelopment" docx

Hóa học - Dầu khí

... to cell-surfaces and co-localized with gK in TGN-labeled membranes Therefore, intracellular transport, cell-surface expression and TGN localization of UL20p and gK are not sufficient for infectious ... important for both intracellular transport and virus-induced cell fusion Domain I is the largest domain (63 aa) and it includes stretches of acidic amino acid (D, E) clusters, which could form electrostatic ... serum albumin in TBS (TBS blocking buffer) before incubation for h with either anti-V5 (Invitrogen, Inc.), for recognition of gK, or anti-FLAG (Sigma Chemical, Inc.), for recognition of UL20p,...
  • 12
  • 526
  • 0
Báo cáo hóa học:

Báo cáo hóa học: "COINCIDENCE AND FIXED POINT THEOREMS FOR FUNCTIONS IN S-KKM CLASS ON GENERALIZED CONVEX SPACES" pot

Báo cáo khoa học

... introduced the class U to be the one satisfying (a) U contains the class Ꮿ of (single-valued) continuous functions; (b) each T ∈ Uc is upper semicontinuous and compact-valued; and (c) for any ... (3.6.3) and (3.6.3) Coincidence and fixed point theorems in S-KKM class (3.6.1) T is compact and closed (3.6.2) T(Y ) ⊆ s(X) + C (3.6.3) Y is closed and C is compact (3.6.3) Y is compact and C is closed ... to be (a) upper semicontinuous (u.s .c. ) if T − (B) is closed in X for each closed subset B of Y; (b) compact if T(X) is contained in a compact subset of Y ; (c) closed if its graph Gr(T) = {(x,...
  • 9
  • 272
  • 0
Báo cáo toán học:

Báo cáo toán học: "Grothendieck bialgebras, Partition lattices, and symmetric functions in noncommutative variables" doc

Báo cáo khoa học

... find that C ∨ (fA ⊗ fB ) = (C ∨ fA ) ⊗ (C ∨ fB ) which is equal to fA ⊗ fB if C ≤ A and C ≤ B (i.e C ≤ A ∧ B) and it is equal to otherwise We conclude from this discussion the following lemma ... Now for B ∈ Πk and C ∈ Πn−k , we have that ρk,n−k (B , C ) ∨ fA = (B |C ) ∨ fA = fA if (B |C ) ≤ A and otherwise If A ∧ (1k |1n−k ) = (B |C) then (B |C ) ∨ fA = fA if and only if B ≤ B and CC ... of the kΠn In light of the Frobenius characteristic of section 2, the basis can be interpreted as an analogue of the Schur functions for NCSym and providing an answer to an open question of...
  • 19
  • 210
  • 0
Báo cáo khoa học:

Báo cáo khoa học: "Comparative analysis of heart functions in micropigs and conventional pigs using echocardiography and radiography" docx

Báo cáo khoa học

... sbir eht fo ytimixorp esolc ehT snosaer lareves rof gnignellahc yllacinhcet si giporcim a fo yhpargoidracohce cicarohtsnarT ]02,81[ gip a fo yhpargoidracohce cicarohtsnart fo stroper wef era ereht ... gnidulcni ,sgiporcim eht fo stnemnorivne gnideerb eht ot eud noitcnuf caidrac eht fo tnempoleved desaerced eht morf tluser eb yam stcepsa eseht ni secnereffid ehT noitcnuf cilotsys eht ni secnereffid ... noitaziretehtac caidraC yretra xelfmucric tfel dna ,yretra gnidnecsed roiretna tfel ,yretra xelfmucric thgir eht fo wolf doolb caidrac eht evresbo ot tuo deirrac saw ypocsoroulf yar-X ]3[ S +...
  • 8
  • 309
  • 0
Báo cáo toán học:

Báo cáo toán học: "Partitions, rooks, and symmetric functions in noncommuting variables" pdf

Báo cáo khoa học

... Thiem, N Branching rules in the ring of superclass functions of unipotent uppertriangular matrices J Algebraic Combin 31, (2010), 267–298 [11] Wolf, M C Symmetric functions of non-commutative ... placements and N CSym The algebra of symmetric functions in noncommuting variables, NCSym, was first studied by Wolf [11] who proved a version of the Fundamental Theorem of Symmetric Functions in ... Electron J Combin 13, (2006), Research Paper 75, 19 pp (electronic) [3] Bergeron, N., Reutenauer, C. , Rosas, M., and Zabrocki, M Invariants and coinvariants of the symmetric groups in noncommuting...
  • 7
  • 286
  • 0
Báo cáo y học:

Báo cáo y học: "Activator protein 1 (Fos/Jun) functions in inflammatory bone and skin disease" pps

Báo cáo khoa học

... protein during embryonic mouse development indicated a possible role for the protein in endochondral ossification Transgenic expression of Fos in many different cell types specifically affected ... osteoblasts, mainly by affecting the activity of the cells through the regulation of matrix production and not by affecting the proliferation or differentiation of cells Mice overexpressing Fra-2 under ... singleknockout and double-knockout mice for JunB and Jun (Figure 3a) Mice harboring conditional JunB and Jun alleles were crossed to K5-Cre-ERT transgenic mice, in which tamoxifen efficiently induced Cre-mediated...
  • 10
  • 325
  • 0
Homo-binding character of LMO2 isoforms and their both synergic and antagonistic functions in regulating hematopoietic-related target genes potx

Homo-binding character of LMO2 isoforms and their both synergic and antagonistic functions in regulating hematopoietic-related target genes potx

Báo cáo khoa học

... sequences were: E-box-GATA+: 5'-GATCTACAGGTGCTATGCGGGGATAGA-3'; E-box-GATA-: 3'-ATGTCCACGATACGCCCCTATCTCTAG-5; GATA-E-box+: 5'-GATCTGGATAGCTATGCGACAGGTGA-3'; GATA-E-box-: 3'-ACCTATCGATACGCT GTCCACTCTAG-5; ... detection are: LMO2-L forward: 5'-CGAAAGGAAGAGCCTGGAC3'; LMO2-S forward: 5'-CGGTGCTGGTCTCACTCTG3'; LMO2-L/S reverse: 5'-TTCACCCGCATTGTCATCT3'; miR-142 forward: 5'-TCTTAGGAAGCCACAAGGAG-3'; Page of ... 5'-TAAGGTGCTCACCTGTCACA3'; GPA forward: 5'-ATTGTCAGCAATTGTGAGCATA3'; GPA reverse: 5'-TGATCACTTGTCTCTGGATTTT-3'; c- kit forward: 5'-GTGAAGTGGATGGCACCTGA-3'; c- kit reverse: 5'-TTGATCCGCACAGAATGGTC-3'...
  • 10
  • 233
  • 0
báo cáo khoa học:

báo cáo khoa học: " AtRabD2b and AtRabD2c have overlapping functions in pollen development and pollen tube growth" pptx

Báo cáo khoa học

... Products were cloned into the pENTR/ AtRabD 2c- R TTAAGAGGAGCAGCAGCCT AtRabD2b-g -F caccATCGCTTATCCGCTCCGTGTATTTC AtRabD2b-g-R TAAAGACCCCTGGTCCTTCAGC AtRabD 2c- g -F caccCTATCTCACTAAGCTGAAGATAC AtRabD 2c- g-R ... GGCAATCTCTCCGGTTTGGTCC b-Tubulin -F CGTGGATCACAGCAATACAGAGCC b-Tubulin-R CCTCCTGCACTTCCACTTCGTCTTC Peng et al BMC Plant Biology 2011, 11:25 http://www.biomedcentral.com/1471-2229/11/25 D vector ... AtrabD 2c- LP1 GCGCATTACTGAGAGAGAAGAG AtrabD 2c- RP1 TCCCATTCTTGGAAACAAGTG AtRabD2b -F ATGAATCCTGAATATGACTAT Cloning AtRabD2b-R TCAAGAAGAACAACAGCCT AtRabD 2c -F ATGAATCCTGAATATGACTAT Promoter::GFP/GUS fusion constructs...
  • 16
  • 209
  • 0
Báo cáo sinh học:

Báo cáo sinh học: "Effects of major histocompatibility complex on antibody response in F 1 and F 2 crosses of chicken lines" ppt

Báo cáo khoa học

... besides the fact that estimation of genotype effects in the C line could be hampered by low numbers of animals, differences of effects between the F and the C line may be interpreted as interaction ... ith sex of the chick, the fixed effect of the jth MHC genotype, the random additive genetic effect on the Ab titer in the kth chick and a random error The sex effect corrected for a higher Ab ... and of U! It is, therefore, better to look at the difference in R between a z full model with and without MHC effect Including MHC effect in the full animal model increased the variation explained...
  • 14
  • 263
  • 0
Báo cáo sinh học:

Báo cáo sinh học: " Identification of a major gene in F and F data when alleles 1 2 assumed fixed in the parental lines" pps

Báo cáo khoa học

... dramatically for smaller data sets Power increased when F data was included in the analysis, and additive effects I of 2a could be detected In that case the increase in variance in F caused by , ... existence of a major gene Assessing the relative importance of the sources of information is useful so as to judge the robustness of the model including F data The effects on non-normality and i increased ... unexplained variance in the model of analysis The inclusion of fixed and polygenic effects will therefore make the major gene easier to detect, provided that all these effects can be accurately...
  • 16
  • 201
  • 0
Role of bcl 2 in metabolic and redox regulation via its effects on cytochrome c oxidase and mitochondrial functions in tumor cells

Role of bcl 2 in metabolic and redox regulation via its effects on cytochrome c oxidase and mitochondrial functions in tumor cells

Cao đẳng - Đại học

... made in Bcl-2, differing only by amino acid sequences and size of the hydrophobic groove, possibly accounting for the different binding affinities for pro-apoptotic proteins between Bcl2 and Bcl-xL ... up-regulation and increased involvement of COX Va and Vb in a variety of cancers Autocrine gastrins-induced up-regulation in COX Vb resulted in decreased cytochrome c release and caspase activation in colon ... depolarization and slight increase in ATP production observed in mock-transfected cells after the initial induction of oxidative stress and subsequent, increase in COX activity Concomitant with the findings...
  • 78
  • 267
  • 0

Xem thêm

Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 động cơ điện không đồng bộ một pha thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008