tfiiia a sophisticated zinc finger protein
Báo cáo y học: "The tandem CCCH zinc finger protein tristetraprolin and its relevance to cytokine mRNA turnover and arthritis" pot
... UAUUUAUAUAUUUAUAUUUUUUAAAUAUUUAUUUAUUUAUUUAUUUAA UAUUUAUAUAUUUAUACUUUUAAAAUAUUUAUUUAUUUAUUUAUUG UAUUUAUAUAUUUAUGUAUUUUAA-UAUUUAUUUAUUUAUUUAUUUAAACUCAUACCCCA UAUUUAUAUAUUUAUGUAUUUUAA-UAUUUAUUUAUUUAUUUAUUUAAGAUCAUACUCUG ... GAUUAUUUAUUAUUUAUUUAUUAUUUAUUUAUUUAC GAUUAUUUAUUAUUUAUUUAUUAUUUAUUUAUUUAC GAUUAUUUAUUAUUUAUUUAUUAUUUAUUUAUUUAC GAUUAUUUAUUAUUUAUUUAUUAUUUAUUUAUUUAC GAUUAUUUAUUAUUUAUUUAUUAUUUAUUUAUUUAC GAUUAUUUAUUAUUUAUUUAUUAUUUAUUUAUUU-GAUUAUUUAUUAUUUAUUUAUUAUUUAUUUAUUUGC ... GAUUAUUUAUUAUUUAUUUAUUAUUUAUUUAUUU-GAUUAUUUAUUAUUUAUUUAUUAUUUAUUUAUUUGC Rat GACUAUUUAUUUAUUAUUUAUUAUUUAUUUAUUUGC Rabbit GAUUAUUUAUUAUUUAUUUAAUAUUUAUUUAUUUGC Pig CAUUAUUAUUUAUUUAUUUAUUUAUUAUUUAUUUAC Woodchuck AAUUAUUUAUUACUUAUUUAUUAUUUAUUUAUUUAC...
- 17
- 416
- 0
Tài liệu Báo cáo khoa học: Crystal structure of the BcZBP, a zinc-binding protein from Bacillus cereus doc
... of GAB catalysis have been identified to date [12] which are based either on a single, bifunctional GAB catalyst or on a GAB catalysts pair The available biochemical data on MshB and LpxC are ... protein families database Nucleic Acids Res 30, 276–280 Handa N, Terada T, Kamewari Y, Hamana H, Tame JRH, Park S-Y, Kinoshita K, Ota M, Nakamura H, Kuramitsu S et al (2003) Crystal structure of ... The Authors Journal compilation ª 2007 FEBS V E Fadouloglou et al References Ivanova N, Sorokin A, Anderson I, Galleron N, Candelon B, Kapatral V, Bhattacharyya A, Reznik G, Mikhailova N, Lapidus...
- 11
- 710
- 0
Tài liệu Báo cáo khoa học: Aldehydes release zinc from proteins. A pathway from oxidative stress⁄lipid peroxidation to cellular functions of zinc pptx
... of ethanol and treatment with disulfiram Alcohol Alcohol 28, 461–468 30 Isse T, Oyama T, Kitagawa K, Matsuno K, Matsumoto A, Yoshida A, Nakayama K, Nakayama K & Kawamoto T (2002) Diminished alcohol ... CA) PAR metal transfer assay Metallochromic indicators provide a rapid means of investigating metal protein equilibria [58,59] PAR is such an indicator Binding of zinc ions changes its absorbance ... Roman J, Gimenez A, Lluis JM, Gasso M, Rubio M, Caballeria J, Pares A, Rodes J & Fernandez-Checa JC (2000) Enhanced DNA binding and activation of transcription factors NF-kappa B and AP-1 by acetaldehyde...
- 11
- 473
- 0
Báo cáo khoa học: A new rice zinc-finger protein binds to the O2S box of the a-amylase gene promoter pptx
... buffer, appropriate CGGTATCGATAAGCTTGATTGACTTGACCGTCA amounts of GA were added to a final concentration of TCGGATTGACTTGACCGTCATCG-3¢, Amyb2: 5¢-CA 10 lM Isolated aleurone tissues were incubated ... treatment and returned to its basal value within 14 h In contrast, Amy2 mRNA reached a maximum at 14 h after the GA treatment (Fig 6B) These data suggest that RAMY could act as a regulatory or transcription ... -KKTTSWVPDPVTGYYRPESHAKEIDAAELRQMLLN AMKESSSSETRAYSSAWAPDPVTGYYRPENCGAEIDAAELREMLLN KSGEEKVR- GGEKVSWVPDPVTGYYRPEN-TNEIDVADMRATVLG KGVEES -TQKISWVPDPKTGYYRPETGSNEIDAAELRAALLN REAEKA -AADSSWVPDPVTGHYRPANRSSGADPADLRAAHLG 101...
- 7
- 359
- 0
Báo cáo khoa học: The Promyelocytic Leukemia Zinc Finger (PLZF ) gene is a novel transcriptional target of the CCAAT-DisplacementProtein (CUX1) repressor ppt
... primer (5¢-aaatgtcttgaccagccgtc-3¢) and Chip2dw primer (5¢-gaaacaaaggcctctcccag-3¢); Chip3up primer (5¢-gctttgcagtcagaatggtc-3¢) and Chip3dw primer (5¢-ctgagcactgactacgaaac-3¢) The Chip1up and Chip1dw ... Seattle, WA, USA) that targeted a conserved sequence in rat, mouse and human CUX1 was kindly provided by Dr Julian Downward [50] Two bases (in capitals) were further mutated (5¢-aagaaga acaGAccagaggattt-3¢) ... were as follows: 5¢-hrmPLZF1923up, 5¢-agcacactcaagagccacaa-3¢; hrmPLZF2056dw, 5¢-tcaaag ggcttctcacctgt-3¢; hrmTBP1009up, 5¢-ggggagctgtgatgtgaagt-3¢; hrmTBP1139dw, 5¢-ggagaacaattctgggtttga-3¢;...
- 13
- 359
- 0
Báo cáo y học: "Defining potentially conserved RNA regulons of homologous zinc-finger RNA-binding proteins" ppsx
... replicates and two technical replicates were analyzed with microarrays, and three biological replicates were analyzed by qMS DNA microarray analysis Microarray data are available at the Stanford ... Sn (c) T 10 T C C A C C T eGis2-TAP F1 T A GA GA GATGA O R G TAG C A T G A C T A G C T C G T C as AC T A T R GA GA GA GA GA GA GA GA G 37 as kDa Ex tr a Er ct v2 Er - v ’U Er 5-O TR v2 R Fc - ... (Bufo arenarum), [AAO73520] (Danio rerio), [AAB62243] (Gallus gallus), [AAA61975] (Homo sapiens), [AAB60490] (Mus musculus), [BAA08212] (Rattus norvegicus), [CAA69031] (Xenopus laevis), [AAI22021]...
- 19
- 262
- 0
Báo cáo y học: "Mutagenesis analysis of the zinc-finger antiviral protein" ppt
... ATATAGGCGGCCGCCTGCAAATATTCTCAC Nm113-AP: ATATAGGCGGCCGCAACATCGTGAGAATA Nm113-SP: ATATAGGCGGCCGCACAGAACTTCCAGAT Nm123-AP: ATATAGGCGGCCGCCTTCAGGATCTGGAAG Nm123-SP: ATATAGGCGGCCGCGCTCTCTGGGCTTAAC ... Nm193-AP: ATATAGGCGGCCGCGTTGTGAGACCTGAGAC Nm193-SP: ATATAGGCGGCCGCCAGAAAGGTGTTGACCA Nm203-AP: ATATAGGCGGCCGCCATGATGGTCAACACC Nm203-SP: ATATAGGCGGCCGCCGGGCTGAGTCCTGAT Nm213-AP: ATATAGGCGGCCGCGACCACATCAGGACTC ... ATATAGGCGGCCGCGAGCCTGATCTCACCCA Nm33-SP: ATATAGGCGGCCGCGCAGCTCTACGAGCTG Nm43-AP: ATATAGGCGGCCGCCTCCAGCAGCTCGTAG Nm43-SP: ATATAGGCGGCCGCGCCCGATCGCTTCGTG Nm53-AP: ATATAGGCGGCCGCCAATAGCACGAAGCG Nm53-SP: ATATAGGCGGCCGCAGGCCAGGCCGGGATC...
- 9
- 226
- 0
Tài liệu Báo cáo khoa học: Catalytic mechanism of SGAP, a double-zinc aminopeptidase from Streptomyces griseus pdf
... involves an acidic residue acting as a general acid ⁄ general base and a di-nuclear metal center participating in binding the substrate and stabilizing the transition state [2,14,35–37] The main data ... 3.4.11.10] and M28E Aeromonas proteolytica aminopeptidase [(AAP) EC 3.4.11.10] In addition, the M28 family includes important human aminopeptidases such as M28B glutamate carboxypeptidase II (N-acetylated, ... the binding affinities to the natural inhibitors bestatin and amastatin are approximately two-fold larger in AAP than in SGAP [10]; and (e) in SGAP, the free amine group of the substrate forms strong...
- 13
- 430
- 0
Tài liệu Báo cáo khoa học: Phage-display as a tool for quantifying protein stability determinants pptx
... Remarkably, we have found that, at least in some circumstances, a quantitative correlation to biophysical data can be obtained from a statistical analysis of selected phage populations [16] We also ... association of the variable heavy chain (VH) with protein A was used as a surrogate for direct stability measurements The VH domains in camelid heavy chain antibodies are most similar to the classical ... individual proteins in a pool of folded variants In addition, a rapid method for quantitatively, and simultaneously, characterizing a large number of mutants would greatly aid in understanding...
- 7
- 502
- 0
Tài liệu Báo cáo khoa học: Crystal structure of a subtilisin-like serine proteinase from a psychrotrophic Vibrio species reveals structural aspects of cold adaptation docx
... hydrogen bonds Main chain–main chain Main chain–side chain Side chain–side chain Total ˚ Exposed surface areab (A2 ) ˚ Apolarc (A2 ) ˚ Buried surface areab (A2 ) ˚ Apolarc (A2 ) a 1IC6 1THM 38 24 ⁄ ... uracil–DNA glycosylase from Atlantic cod (Gadus morhua) reveals cold-adaptation features Acta Crystallogr Sect D 59, 1357–1365 10 Aghajari N, Van Petegem F, Villeret V, Chessa JP, Gerday C, Haser ... adaptation surface with their hydrophilic nature may enhance favourable electrostatic interaction with water at low temperature and, at the same time, result in an anionic character, which may...
- 14
- 597
- 0
Tài liệu Báo cáo khoa học: Novel aggregate formation of a frame-shift mutant protein of tissue-nonspecific alkaline phosphatase is ascribed to three cysteine residues in the C-terminal extension pdf
... alkaline phosphatase gene from hypophosphatasia patients J Bone Miner Res 13, 1827–1834 Cai G, Michigami T, Yamamoto T, Yasui N, Satomura K, Yamagata M, Shima M, Nakajima S, Mushiake S, Okada ... (ordinate, unit per mL fraction) BSA (b, 68 kDa), alcohol dehydrogenase (a, 141 kDa) and catalase (c, 250 kDa) were loaded on to a separate gradient as molecular mass markers Not only the aggregate ... Komaru et al Novel aggregate formation of an alkaline phosphatase frame-shift mutant Hypophosphatasia is an inborn error of metabolism characterized by defective mineralization of hard tissues and...
- 14
- 445
- 0
Tài liệu Báo cáo Y học: Systematic search for zinc-binding proteins in Escherichia coli potx
... zinccontaining proteins, Fba (fructose-1,6-bisphosphatase aldolase), LpdA (lipoamide dehydrogenase), Ppa (inroganic pyrophosphatase), Pta (phosphotransacetylase) and RpoA (RNA polymerase a subunit) ... cell lysate (A and C, lg; B and D, lg), BSA (A and C, lg; B and D, lg), RNA polymerase (A and C, lg; B and D, lg) and RpoD (RNA polymerase r subunit) (A and C, lg; B and D, lg), by SDS/PAGE After ... Function AckA DnaK Fba* GlyA LpdA* (AtpA) Ppa* (AhpC) 10 11 12 Pta* RpoA* RplB RplM RpsB RpsO/RpsP/RpsQ 13 14 TktA/TktB Tsf Acetate kinase Hsp70 chaperone Fructose 1,6-bisphosphatase aldolase Serine...
- 11
- 555
- 0
Tài liệu Báo cáo Y học: Regulation of transcription of the Dnmt1 gene by Sp1 and Sp3 zinc finger proteins doc
... Murakami, H., Tsutsui, H., Tang, X., Matsumura, M., Itakura, K., Kanazawa, I., Sun, K & Yokoyama, K.K (1998) Genomic organization and expression of a human gene for Mycassociated zinc finger protein ... upon addition of antibodies against Sp3 (lane 4) Both antibodies against Sp1 and against Sp3 affected the migration of all retarded bands In contrast, anti-(AP-2) Ig did not affect the migration ... recovered by addition of protein A/ G PLUS-agarose beads (Santa Cruz Biotech., Santa Cruz, CA, USA) with incubation at °C for h After the beads had been washed extensively, DNA was eluted and cross-linking...
- 10
- 563
- 0
Peptidylarginine deiminase (PAD) is a mouse cortical granule protein that plays a role in preimplantation embryonic development docx
... Laboratories (Burlingame, CA) SYTOX orange nucleic acid stain and Alexa-488 conjugated to goat anti-rabbit IgG were obtained from Molecular Probes (Eugene, OR) PAD V (N) antibody was made against ... cortical granules contain PAD To ascertain if mouse cortical granules contain PAD, antibodies made against mouse ePAD and human recombinant PAD V (anti-PAD V (N)) were used to label in vivo matured ... secreted PAD binds back to the oolemma as a peripheral membrane protein Alternatively, the PAD associated with the oolemma may represent a different isoform of PAD that is in fact an integral membrane...
- 22
- 519
- 0
Báo cáo khoa học: Functional analysis of a murine monoclonal antibody against the repetitive region of the fibronectin-binding adhesins fibronectin-binding protein A and fibronectin-binding protein B from Staphylococcus aureus pot
... (D, E) After several washings, lg of rabbit polyclonal antibody against S aureus was added Bound antibody was detected by incubation with secondary antibody [HRP-conjugated goat anti-(rabbit IgG)] ... FITC was measured in the FL1 channel (510–535 nm bandpass filter) Data were recorded and analyzed with flowmax software from Partec Statistical analysis of ELISA experiments Each experiment was repeated ... mediated by several distinct repeats on both FnBPA and FnBPB, adhesion of bacteria to surface-coated Fn was inhibited significantly by the mAb, suggesting that the antibody-targeted repeats play a...
- 16
- 560
- 0
Báo cáo khoa học: Evolutionary changes to transthyretin: structure and function of a transthyretin-like ancestral protein doc
... Pf5 ATCC BAA-477 Actinobacteria, Actinobacteria Proteobacteria, Alphaproteobacteria Proteobacteria, Alphaproteobacteria Proteobacteria, Alphaproteobacteria Proteobacteria, Alphaproteobacteria Proteobacteria, ... Proteobacteria, Alphaproteobacteria Proteobacteria, Betaproteobacteria Proteobacteria, Betaproteobacteria Proteobacteria, Gammaproteobacteria Proteobacteria, Gammaproteobacteria Proteobacteria, Gammaproteobacteria ... characteristics of transthyretins and TLPs are indicated above the alignment: motifs A –C’ are indicated with straight lines and are labelled; b-strands are indicated with arrows and are labelled...
- 13
- 390
- 0
Báo cáo khoa học: Kinetically controlled refolding of a heat-denatured hyperthermostable protein pot
... Voyager DE-RP mass spectrometer, Framingham, MA, using sinapinic acid crystallized on a gold-coated well plate; spectra were calibrated with protein standards) LamA is a single domain globular-ellipsoid ... intermediate state Notably, this partially folded non-native state of LamA, after thermal denaturation at 109 °C, may refold to the native conformation either by ultra-slow cooling immediately after ... obtained after baseline subtraction and data processing using the formulation of Privalov [32] Enzymatic activity tests The enzymatic activity of LamA before and after heat treatment was measured...
- 9
- 238
- 0
Báo cáo khoa học: Characterization of a cathepsin L-associated protein in Artemia and its relationship to the FAS-I family of cell adhesion proteins pot
... CLAP_1:AGGACCTTTTATTAGACATTTCAAATATATAATAAACGTTATTTTAAAATTAGAAAAATTGAAAGACAAGCTAATGAAAGCTTATTGCCGATTGGAAAGT CLAP_2:AGGACCTTTTATTAGACATTTCAAATATATAATAAACGTTATTTTAAAATTAGAAAAATTGAAAGACAAGCTAATGAAAGCTTATTGCCGATTGGAAAGT ... CLAP_2:ATTAGTGCTATAGTTTGGGAAATATTTAGTCCTTGTTTTGTGTGATCTTATAAGATAATATTTGTAGTTTGTGCTTTTATATAATTTAGCTCATTGGATT 1730 * 1888 CLAP_1:AAGATCTTCTGAATGTGATTATATGCGGCTGTGTTTTCTAATAGATTTCTAGATACGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA CLAP_2:AAGATCTTCTGAATGTGATTATATGCGGCTGTGTTTTCTAATAGATTTCTAGATACGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA (A) 48 ... CLAP_1:AAGTCTGTCGTCAAAATGTTATGAACGTCTCTTGTCATAAAGAAAGATAACCTCTCTTTTTAGTTTGGTTTAGATATTAAGGACAGATCCAAAATATTTG CLAP_2:AAGTCTGTCGTCAAAATGTTATGAACGTCTCTTGTCATAAAGAAAGAGAACCTCTCTTTTTAGTTTGGTTTAGATATTAAGGACAGATCCAAAATATTTG * CLAP_1:AGGACCTTTTATTAGACATTTCAAATATATAATAAACGTTATTTTAAAATTAGAAAAATTGAAAGACAAGCTAATGAAAGCTTATTGCCGATTGGAAAGT...
- 12
- 772
- 0
Báo cáo khoa học: The crystal structure of NlpI A prokaryotic tetratricopeptide repeat protein with a globular fold potx
... aaagtgaagtcc-3¢ and 5¢-attattggatccctattgctggtccgattctgccag-3¢ 3-TPR NlpI primers (residues 62–197) were 5¢-aataatccatgg gggcacagcttttatatgagcgcggag-3¢ and 5¢-aataatggatcctcactgttc cttatccgatttttcgaagtgc-3¢ ... chemically synthesized by the W M Keck Core Facility (Yale University, New Haven, CT, USA) Primers to amplify mature NlpI (residues 20–294) were 5¢-aataatccatggggagtaatacttcctggcgta aaagtgaagtcc-3¢ ... Monomer A (main chain ⁄ side chains) Monomer B (main chain ⁄ side chains) Water molecules Ramachandaran plot (%) (most favoured ⁄ allowed ⁄ disallowed) ˚ rmsd bond lengths (A) rmsd angles (°) a Values...
- 14
- 433
- 0
Báo cáo khoa học: Binding of the volatile general anesthetics halothane and isoflurane to a mammalian b-barrel protein doc
... thermodynamic parameters underlying halothane and isoflurane binding to the porcine odorant binding protein are given in Table Halothane displaces 1-aminoanthracene (AMA) bound to the internal cavity ... odorant binding protein Figure shows that halothane can displace AMA from the porcine odorant binding protein cavity The competition curve was treated as a two parameter Table Dissociation constants ... a combination of aliphatic and charged residues, such as arginine or lysine, with the remaining two composed of aliphatic and somewhat polar residues such as serine, phenylalanine, and asparagine...
- 9
- 421
- 0
Tìm thêm: khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến dòng điện stato i1 fi p2 thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose