soil enzymes as functional indicators
báo cáo hóa học: " Quality of life data as prognostic indicators of survival in cancer patients: an overview of the literature from 1982 to 2008" pot
... 2000 227 metastatic and early stage breast cancer Physical well-being + mood, appetite, and coping (as QOL index) Disease-free survival was not significantly predicted by QOL scores at baseline or ... for every 10point decrease in social functioning score, as measured by the EORTC QLQ-C30, there was a 6% increase in the likelihood of an earlier death [76] This study was the first external validation ... Sleepiness Scale; FACIT-F: Functional Assessment of Chronic Illness Therapy-Fatigue scale; FACT-Br: Functional Assessment of Cancer Therapy-Brain module; FACT-G: Functional Assessment of Cancer Therapy-General...
- 21
- 717
- 1
Báo cáo sinh học: " Understanding tumor heterogeneity as functional compartments - superorganisms revisited" pot
... addressing only the proliferating caste is not likely to succeed in eradicating all tumor cells in all compartments, as well as those on the move (G phase during metastasis) To kill an ant colony effectively ... Microenvironmental regulation of metastasis Nat Rev Cancer 2009, 9:239-252 81 Kumar S, Weaver VM: Mechanics, malignancy, and metastasis: the force journey of a tumor cell Cancer Metastasis Rev 2009, 28:113-127 ... metastases Nat Rev Cancer 2009, 9:302-312 84 Bidard FC, Pierga JY, Vincent-Salomon A, Poupon MF: A “class action” against the microenvironment: cancer cells cooperate in metastasis? Cancer Metastasis...
- 11
- 284
- 0
báo cáo hóa học:" Understanding tumor heterogeneity as functional compartments - superorganisms revisited" pdf
... addressing only the proliferating caste is not likely to succeed in eradicating all tumor cells in all compartments, as well as those on the move (G phase during metastasis) To kill an ant colony effectively ... Microenvironmental regulation of metastasis Nat Rev Cancer 2009, 9:239-252 81 Kumar S, Weaver VM: Mechanics, malignancy, and metastasis: the force journey of a tumor cell Cancer Metastasis Rev 2009, 28:113-127 ... metastases Nat Rev Cancer 2009, 9:302-312 84 Bidard FC, Pierga JY, Vincent-Salomon A, Poupon MF: A “class action” against the microenvironment: cancer cells cooperate in metastasis? Cancer Metastasis...
- 11
- 316
- 0
Báo cáo hóa học: " Research Article Study of Harmonics-to-Noise Ratio and Critical-Band Energy Spectrum of Speech as Acoustic Indicators of Laryngeal and Voice Pathology" ppt
... the study was small 26 normal subjects were used for testing the classifiers; the classifier based on HNR features misclassified two of them while the other misclassified one of them It was observed ... pathologic class The rule is if Dpc < Dnc , then the test sample is considered as pathologic, otherwise as normal 2.5.3 Classification based on energy spectrum We define spectral distance SD as the Euclidean ... and pathologic cases, respectively Based on the above spectral distance measures, the given test sample is classified into the normal class if SDn ≤ SD p or into the pathology class otherwise PERFORMANCE...
- 9
- 275
- 0
Whey Products as Functional Foods pot
... components as having significant contributions to “physiologically functional foods.” Since then there has been an increasing number of investigations that have supported this view Functional ... Functional Foods Functional foods have been defined as “any food or food ingredient that may provide a health benefit beyond the traditional nutrients that it contains.” Functional ... Prostate (p) Gastric/stomach (g) Breast (b) Skin (s) *based on cellular and animal models Protection from Some Cancers Cancer WPC LF/LP CLA BSA Peptides colon + + + + + breast + + + + skin...
- 34
- 177
- 0
Báo cáo khoa học: "Plasma haptoglobin and immunoglobulins as diagnostic indicators of deoxynivalenol intoxication" potx
... The release of APPs from hepatocytes and other APPs producing organs was stimulated by pro-inflammatory cytokines such as IL-6, IL-1 and TNF-α, as well as by malnutrition [1,11,19] DON was observed ... intoxication In our study, haptoglobin was increased only by DON, but not by ABF1 and ZEA Haptoglobin was slightly decreased by 240 mg/kg bw ZEA and it was completely decreased to the undetectible range ... intoxication when a case of mycotoxicosis is suspected Haptoglobin is a positive APP, and it is increased in the blood plasma by bacterial infectious diseases and viral diseases, and for this reason haptoglobin...
- 10
- 320
- 0
Báo cáo khoa học: "Evaluation of Clinical and Laboratory Variables as Prognostic Indicators in Hospitalised Gastrointestinal Colic Horse" pdf
... protein in EDTAplasma and serum Serum sodium was measured with an ion-selective electrode,1 serum chloride was measured with a colorimetric method,2 and plasma lactate was measured enzymatically.3 ... values can be measured as a horse side test Sandholm et al (1995) concluded that D-dimer values in plasma were valuable as a predictor for outcome in equine gastrointestinal colic cases The purpose ... valuable in assessment of the cardiovascular status Increased levels indicate that excessive amount of fibrin is formed within the vascular system as a result of disseminated intra-vascular coagulation...
- 10
- 237
- 0
Báo cáo y học: "Aberrant glycosylation associated with enzymes as cancer biomarkers" pptx
... N-glycans as a result of over-expression of GlcNAcT-V in cancer plays an important role in tumor metastasis Increased b1-6 branched N-glycans have been associated with lymph node metastasis in breast ... in breast and gastric carcinomas, which make them as potential tissue biomarkers[21-25] Because aberrant glycoproteins as a result of these enzymes may be involved in promoting tumor invasion ... [2,3] Urokinase plasminogen activator (uPA), a serine protease, is a prognostic marker for newly diagnosed breast cancer patients with lymph node-negative disease[4,4-7] During the last decade,...
- 14
- 134
- 0
Quartz sensor array with mesoporous silica films as functional materials
... ionized is referred to as plasma [45] Inductive coupled plasma system is used in this study to generate and sustain the plasma In this technique, plasma of gases such as nitrogen, oxygen, argon, ... for enhanced gas sensing The frequency shift-mass change relationship of the QCM, as demonstrated by Sauerbrey [20] , has been exploited during the past few decades for chemical and gas/bio sensing ... with plasma powers of 50, 100, and 200 W Disordered pores with wide diameter variations are obtained The degree of porosity increases with the increase of processing time as well as the plasma...
- 94
- 319
- 0
Tài liệu Báo cáo khoa học: Accessibility changes within diphtheria toxin T domain when in the functional molten globule state, as determined using hydrogen⁄deuterium exchange measurements pdf
... continuous change of the isotopic profile was measured at pD 7, whereas the peptide remained nondeuterated at pD This result indicated that this peptide was fully protected against H ⁄ D exchange ... estimated molecular mass was around 37 kDa (Fig 7B), which is close to the theoretical molecular mass of a dimer (44.6 kDa) At pH 4.0, the elution volume of the T domain was quite similar to that ... chromatography was used to test this hypothesis (Fig 7) The results showed that the elution volume of the T domain was increased at pH 4.0 compared with pH 7.0 Comparison with molecular mass markers...
- 10
- 530
- 0
Tài liệu Freshwater sponges as indicators of water pollution: an investigative undergraduate lab pdf
... as the absence of a well defined water vascular system) As mentioned earlier, normal sponge growth typically includes the production of a distinct water vascular system with a less dense cellular ... Fuel stabilizer PVC tubing Plastics for food packaging Toxic Effects Suspected gastrointestinal and liver damage in humans Bis-phenol-A Epoxy-resin & polycarbonate plastic production Food packaging ... Bisphenol-A: An estrogenic substance is released from polycarbonate flasks during autoclaving Endocrinology 132: 2279-2286 Routledge E.J., J Parker, J Odum, J Ashby, and J.P Sumpter 1998 Some alkyl...
- 5
- 344
- 0
Tài liệu Báo cáo khoa học: Deciphering enzymes Genetic selection as a probe of structure and mechanism docx
... chorismate mutase–prephenate dehydratase and chorismate mutase–prephenate dehydratase were deleted Monofunctional versions of the dehydratase and the dehydrogenase are provided by plasmid pKIMP-UAUC ... Deciphering enzymes (Eur J Biochem 271) 1631 Fig Selection system for chorismate mutase activity in Escherichia coli An E coli strain (KA12) was engineered in which the genes encoding the bifunctional enzymes ... and 78 were varied in tandem, however, an Asp at position 75 was able to substitute for Glu78, provided Ala, Ser, Met or Val was present at position 78 As functional solutions lacking an anion were...
- 8
- 635
- 0
Báo cáo " Effects of using wastewater as nutrient sources on soil chemical properties in peri‐urban agricultural systems " ppt
... cations such as Na and K in wastewater led to an increase in EC and exchangeable Na and K in soils irrigated with wastewater. The high pH of soils irrigated with wastewater might ... For assessment of the impact of wastewater, soil samples were taken from the topsoil (0‐20 cm) of all study sites in peri‐urban areas of Hanoi (n=4) and Nam Dinh (n=8) using a soil ... of this paper was to quantify the effects of reuse of wastewater as nutrient sources by: (i) investigating the effects of long‐term wastewater irrigation on soil pH, EC, organic ...
- 10
- 313
- 0
Concentration and distribution of extractable elements in soil as affected by tillage systems and fertil
... other soil componentsa Treatment Depth Žcm 0᎐5 OM % Exchang P ppm pH Exchang Cab Exchang Mg Exchang K Extract Al ppm ZT CT Past ZT CT Past ZT CT Past ZT CT Past ZT CT Past ZT CT Past ZT CT Past ... copper, iron, lead and manganese Žmgrkg a Element Treatment Depth Žcm 0᎐5 As ZT CT Past ZT CT Past ZT CT Past ZT CT Past ZT CT Past Pb Cu Fe Mn 5᎐10 10᎐15 15᎐20 0.058 aA 0.059 aA 0.087 bA 0.943 aA ... Air Soil Pollut 1993b;74:251᎐265 Jeng AS, Slingh BR Cadmium status of soils and plants from a long-term fertility experiment in southeast Norway Plant Soil 1995;175:67᎐74 Lee BD, Carter BJ, Basta...
- 7
- 380
- 0
Effect of cd and as in soil on growth availability to plant
... Table Soil was treated with Na2HAsO4, to 3, 6, 10, 15, 30 mg kg-1 of As soil and CdCl2·2½H2O, to 5, 10, 25, 50, 100 mg kg-1 of Cd soil As and Cd were measured by inductively coupled plasma emission ... 10-25 mg kg-1 of As treated soils, respectively However, there was no significant reduction of chinese cabbage yield under 30 mg kg-1 of As treated soils As at 30 mg kg-1 soils was associated with ... respectively Kabata-Pendias and Pendias (1984) reported that there was a linear relationship between As content of vegetation and soluble As concentration in soils and plants take up As passively with the...
- 9
- 379
- 0
Báo cáo khoa học: Functional analysis of cell-free-produced human endothelin B receptor reveals transmembrane segment 1 as an essential area for ET-1 binding and homodimer formation pptx
... for the functional folding of other membrane proteins, such as the nucleoside transporter Tsx, during CF expression [15] CF-produced precipitates of Tsx as well as of ETB did not adopt functional ... response was lower than might be expected if the relatively high mass of the receptor used as analyte is considered Ligand occlusion by immobilization on the sensor chip surface, as well as limited ... micelles upon translation The efficiency of this solubilization mode was nearly 100% in the case of ETB, as no residual precipitate was detectable and expression levels were similar to those obtained...
- 13
- 433
- 0
Animal waste utilization effective use of manure as a soil resource
... classified by whether manure was discussed as a waste, an asset, or whether the characterization was ambiguous — neither waste nor asset (Dittrich, 1993) Manure was largely viewed as a farm asset ... knowledge regarding soil management and basic soil processes He has an active research program in soil- plant-atmosphere interactions with emphasis on the energy exchanges as the soil surface under ... system and reclassified as a system externality or waste If manure was even mentioned in these production models, it was only considered as detrimental to the herd environment, a waste that should...
- 319
- 5,613
- 0
Báo cáo Y học: Synthesis of phosphoenol pyruvate (PEP) analogues and evaluation as inhibitors of PEP-utilizing enzymes pot
... pyruvate kinase/L-lactate dehydrogenase assay Obviously, this methodology was not applied with compounds 1b–e (also 1f and 2f when Mn2+ was present) as they are good inhibitors of pyruvate kinase In ... Pyruvate kinase activity was determined in a coupled assay with L-lactate dehydrogenase The initial rates of formation of pyruvic acid released from PEP were monitored by the decrease of absorption ... synthase, and pyruvate phosphate dikinase, or the presumed active-site aspartic acid residue of phosphoenolpyruvate mutase [36] The synthesis of the chloromethylphosphonate 3c was accomplished as...
- 11
- 642
- 0
Báo cáo khoa học: "A PROLOG IMPLEMENTATION OF LEXICAL LANGUAGE FUNCTIONAL PROCESSING GRAMMAR SYSTEM AS A BASE FOR A NATURAL" pdf
... relationships in the same way as for intrasentential ones ~ is the second requirement: a s~antic representation has to represent the discourse as a whole and not as the mere union of the s~antic ... a translation procedure which is based on the association of formulas of intensional logic to the semantic forms appearing in the functional structure The reason not to take this approach will ... (9) John bought a car the engine has 160 horse powers In this case one has to take into account some ~nowledge of the world, nanely the fact that every car has exactly one engine To illustrate...
- 6
- 476
- 0
Báo cáo khoa học: Identification of the N-terminal region of TjZNT2, a Zrt⁄Irt-like protein family metal transporter, as a novel functional region involved in metal ion selectivity ppt
... series was obtained from the European S cerevisiae Archive for Functional Analysis (Frankfurt, Germany) The strains were grown in yeast nitrogen base (YNB) medium (0.67% yeast nitrogen base without ... exponential phase in YNB medium at 30 °C, and imaged with a laser scanning confocal microscope (FV 1000; Olympus, Tokyo, Japan) Metal accumulation assay The Cd2+ accumulation assay was performed as described ... activity It was found that DN36 complemented the zrt1 mutant (Fig 4A), Nα Nβ TjZNT1 TjZNT2 1: -MASSPTKILCDAGESDLCRDDAAAFLLKFVAIASIL 1:MFFIDVLWKLFPLYLFGSERDYLSETESILKIVPETMAAASSLSILCDAGEPDLCRDDSAAFLLKLVAIASIF...
- 8
- 343
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến tốc độ rôto n fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose