... constant factor,” Journal of Mathematical Analysis and Applications, vol 343, no 2, pp 1154–1160, 2008 B Yang, “On an extended Hardy-Hilbert s inequality and some reversed form,” International ... 3.5 taking the form of strict inequality, 0, then both constant factors, K and K p of 3.1 and 3.2 , are the best possible Proof We only prove that K is the best possible If the constant factor ... inequality with some parameters,” Acta Mathematica Sinica Chinese Series, vol 49, no 5, pp 1121–1126, 2006 Z Xie, A new Hilbert-type inequality with the kernel of -3μ-homogeneous,” Journal of...
... m-accretive operators as a special case The class of H-accretive operators was first introduced and studied by Fang and Huang [5], and also includes that of m-accretive operators as a special case ... quasi-variational inclusions, generalized quasi-variational inclusions, quasi-variational inequalities, implicit quasi-variational inequalities studied by many authors as special cases, see, for example, [1, ... (A, η)-accretive mappings and the resolvent operators associated with (A, η)-accretive mappings due to Lan et al., to study a new class of multivalued nonlinear variational inclusion problems with...
... first metatarsal (D1MT) to the NAV marker (Figure 4) Plantar fascia strain is a unitless measure calculated by approximating the plantar fascia as spanning between the first metatarsal head (D1MT) ... NAV, and MCAL markers for the purpose of calculating plantar fascia strain (PFS) and medial longitudinal arch (MLA) angle values The MLA angle was calculated in a manner similar to Tome et al ... another gait study that has calculated strain within the plantar fascia, the results are consistent with previous hypotheses of how orthoses may function to treat plantar fasciitis and minimize arch...
... exchangers are finite The total heat transfer surface area ( F ) of the two heat exchangers is assumed to be a constant: F = F1 + F2 (3) There exists a constant rate of bypass heat leakage ( ... flows through the system in a quasistatic-state fashion The cycle consists of two isothermal processes and two adiabatic processes All four processes are irreversible (2) There exist external ... coefficient and F1 is the heat- transfer surface area of the hightemperature-side heat exchanger , β is the overall heat transfer coefficient and F2 is the heat- transfer surface area of the low -temperature- side...
... radiation decade at the most (infrared) and this is absorbed by the greenhouse gases (a natural as well as manmade part of the - Scientist at NASA, Dr James Hansen earth s atmosphere which have ... interviews and U .S Supreme Court ruled that CO2 and other heat newspaper advertisements The campaign s trapping emissions are air pollutants under the Clean newspaper advertisements made statements such ... catastrophe what about to become a hot and barren desert’ automatically jumps to mind are events that occur in an instant such as earthquakes, tsunamis and landslides Many people fail to consider...
... hours, instead of three days John Palmer was lessee and manager of the Bath and Bristol theatres, and went about beating up actors, actresses, and companies in postchaises, and he thought letters ... London; also by Mr L.C Kerans, expostmaster of Bath, and Messrs S. I Toleman and G.E Chambers, ex-assistant Superintendents of the Bristol Post Office I have gathered many interesting facts from "Stage ... was actually born in the General Post Office, St Martin 's- le-Grand, London, where her father had a residence as Assistant Secretary, has in her possession several "antiques" belonging to her ancestors...
... of Sponsorship Success Sponsorship success may be defined as the degree to which a sponsorship reaches its objectives with its given resources The previous discussion has shown that sponsors’ ... use of sponsorship Predominantly analysis of Sandler and Shani 1989 ambush marketing practices Meenaghan 1994 Legal and ethical considerations Legal constraints and tax Ledwith 1984 in sponsorship ... two case studies at a popular Swiss youth sports event Research question 2a (“Is there a causal relationship at all?”) was approached using a mix of quantitative and qualitative methods Mainly,...
... Also an attempt has been made to use this program for subsite mapping of other a- amylases found in the literature Evaluations of subsite maps of rice and barley a- amylases are thus also presented ... MATERIALS AND METHODS SUMA software: subsite mapping of amylases This software calculates the apparent binding energies on the basis of the measured bond cleavage frequencies The calculations ... data of Table Fig Subsite maps for porcine pancreatic a- amylase (PPA) The solid bars are related to CNP-modified maltooligosaccharide substrates [8] and the open bars depict the subsite map with...
... methods, like scoring models and methods assessing qualitative and quantitative information The IIA s Standards state that internal audit activities should assist the organisation by identifying and ... assess the reliability of the accounting system and information and of resulting financial reports; • a compliance audit aims to assess the quality and appropriateness of the systems established ... ensure compliance with laws, regulations, policies and procedures; • an operational audit aims to assess the quality and appropriateness of other systems and procedures, to analyse the organisational...
... pathways as MAPK kinase kinase ASKs are activated in response to various cytotoxic stresses, including oxidative stress and UV irradiation, and play an essential role in stress-induced apoptosis [40,41] ... targets of p38 MAPK signaling in HeLa cells treated with H2O2 Apoptosis signal-regulating kinases (ASKs) are serine ⁄ threonine kinases that activate both the p38 MAPK and JNK signaling pathways ... regulates stress-induced apoptosis, understanding the action of Hsp10 5a and Hsp105b in apoptosis may offer novel ways of treating apoptosis-related diseases, such as cancer, injury after ischemia,...
... HMSGQPAVDLNKKVQDAVKEAEDACAKGTSADCAVAWDTVEELSAAVSHKK KVQDAVKEAEDACAKGTSADCAVAWDTVEELSAAVSHKK VQDAVKEAEDACAKGTSADCAVAWDTVEELSAAVSHKK ADVTLTDPLEAFCKDAPDADECRVYED ADVTLTDPLEAFCKDAPDADECR GTSADCAVAWDTVEELSAAVSHKK C66 and ... Fragments obtained without missed cleavages HHHHHHHHHHSSGHIEGR (His-tag) GTSADCAVAWDTVEELSAAVSHK ADVTLTDPLEAFCK DAPDADECR VYED Fragments with one or more missed cleavages HMSGQPAVDLNKKVQDAVKEAEDACAKGTSADCAVAWDTVEELSAAVSHKK ... modulate the activity of a partner molecule, assemblers that act as a linker, or scavengers that store small ligands [32] As a consequence, this novel class of proteins has ‘come of age’ and their...
... second stage amidolytic assay are shown in parentheses Vmax is the rate of substrate hydrolysis, as measured by the change in absorbance at 405 nm over a period of 20 In all cases the change was linear ... curves for M27 Fab interaction with AT Data obtained by surface plasmon resonance experiments were analyzed using the BIAEVALUATION 3.0 software package Symbols represent actual data points and solid ... chromatography on a Q-Sepharose Fast Flow column that was eluted witha linear NaCl gradient (0–250 mM) The Fab fragment eluted at 70 mM NaCl It was homogenous, as judged by SDS/ PAGE, and was able...
... kinematics/kinetics patterns Conclusion Other areas (Attentional cue) Progression of Parkinson s Disease Figure stimuli Schematization of responsiveness of PD subjects to visual Schematization of responsiveness ... motor area and other areas (associative, sensory), versus disease progression The results of the present study suggest that gait behaviours of PD subjects can be influenced by optical stimulation ... data collection and analysis and drafted the manuscript MR and RP participated in the design of the study, data analysis and helped to draft the manuscript MT participated in data analysis and...
... les operations dans les ensembles abstracts et leur application aux équations intégrales Fundamenta Mathematicae 3, 133181 (1922) Chatterjee, SK: Fixed point theorems Comptes Ren Acad Bulgaria ... contraction maps as a subclass, has been proposed in [28] to investigate the convergence and existence results of best proximity points in reflexive Banach spaces completing previous related results ... in any of the subsets, and located within two distinct of such subsets for all the iteration steps, asymptotically converge to the distance D between such subsets in uniformly convex Banach spaces,...
... Cho, S H Shim, N.-J Huang, and S M Kang, “Generalized strongly nonlinear implicit quasivariational inequalities for fuzzy mappings,” in Set Valued Mappings with Applications in Nonlinear Analysis, ... introduce and study a class of general nonlinear random equations with random fuzzy mappings in Banach spaces By using Chang s lemma and the resolvent operator technique for H, η -accretive mapping ... mappings in Banach spaces The set of measurable mappings x, u, v, w is called a random solution of 2.7 Some special cases of 2.7 : If G is a single-valued operator, p ≡ I, where I is the identity mapping...
... quasi-variational inclusions, generalized (random) quasi- variational inclusions, quasi-variational inequalities, and implicit quasi-variational inequalities as special cases of the Equation (1.1) ... studied a new class of nonlinear variational inclusion systems with (A, η)accretive mappings in q-uniformly smooth Banach spaces and developed some new iterative algorithms to approximate the solutions ... ρ ,A Rη,M (u) = (A + ρM )−1 (u), ∀u ∈ B Remark 2.3 The resolvent operators associated with (A, η)-accretive mappings include as special cases the corresponding resolvent operators associated with...
... Journal of Inequalities and Applications For the special case that n and p 1, various problems on the solutions of 1.1 , such as the existence of periodic solutions, bifurcations of periodic solutions, ... Nonlinear Analysis: Theory, Methods & Applications, vol 31, no 1-2, pp 45–54, 1998 10 J Llibre and A. -A Tarta, “Periodic solutions of delay equations with three delays via bi-Hamiltonian ¸ systems,” ... Journal of Inequalities and Applications Acknowledgments The authors would like to thank the referee for careful reading of the paper and many valuable suggestions Supported by the specialized Research...
... nhiệt, thùng ch a dầu, s van thiết bị s y dầu điện trở 2.2 Ngun lý họat động hệ thống Ngun lý họat động mơ sau: vào ban ngày, bơm tuần hồn hoạt động lúc van 15,17, 19, 20 mở, van 18 đóng lại, ... đủ để gia nhiệt cho dàn trao đổi nhiệt ống lồng ống, lúc s dụng nước dự trữ tank lớn để gia nhiệt cho tank nhỏ cách đóng van 13, 23, mở van 12, 14 , 15, 16, 17, 19, 20, hai bơm 5A họat động, ... 10 Tần s dao động riêng thu 11 Tốc độ góc tia nắng ω=2Π/τn s- 1 0,727.10-4 b=W/C rad /s 4.1 Tính tóan thơng s đặc trưng Collector Bảng Các thơng s đặc trưng Collector phẳng m STT Thơng s đặc...