single cell protein from mycelial fungi

Single cell protein introduction

Single cell protein introduction

Sinh học

... Single cell protein concept  Single cell protein is a terms for a type of cell nutrient and it produced by microorganisms  Microbial species capable of single cell protein synthesis ... filamentous fungi, algae Yeast Algae Bacteria Filamentous Fungi Advantages and disadvantages Advantages of single cell protein: • Disadvantages of • Protein in high cell • Slow digestion by the cell ... cell structure • • Good quality protein • Safety toxins single cell protein: • High nucleic acids produce many uric acids in the blood Application of single cell protein In the food industry: •...
  • 7
  • 116
  • 0

Báo cáo Y học: Modelling of simple and complex calcium oscillations From single-cell responses to intercellular signalling pdf

Báo cáo Y học: Modelling of simple and complex calcium oscillations From single-cell responses to intercellular signalling pdf

Báo cáo khoa học

... However, cellular Ca2+ transients also have a spatial dimension In the cytoplasm of single cells, Ca2+ gradients can be observed when Ca2+ release from the ER is excited at particular subcellular ... the cells, these can be assumed proportional to the concentration differences across the junctions for each substance For example, for a pair of coupled cells the junctional fluxes from cell to cell ... the cells is necessary for the maintenance of oscillations Removal of external Ca2+ leads to a cessation of oscillations in most cases in endodermal cells [62] and HeLa cells [63] In other cell...
  • 23
  • 180
  • 0

báo cáo khoa học: " Simultaneous measurement of sensor-protein dynamics and motility of a single cell by on-chip microcultivation system" pps

báo cáo khoa học:

Báo cáo khoa học

... proteins and the motility of single cells simultaneously, we used the on-chip microcultivation system and assayed intracellular proteins tagged with green fluorescent protein (GFP) In this paper, ... by measuring the tumbling frequency and the protein- localization dynamics When the cell divided into two daughter cells, one of these two daughter cells was picked up by optical tweezers, transported ... generation with focusing each individual cell caused by the environmental change Authors' contributions II carried out the microchamber design, cell preparation, single cell observation, image analysis...
  • 4
  • 55
  • 0

Báo cáo y học: " Identification of a novel motif responsible for the distinctive transforming activity of human T-cell leukemia virus (HTLV) type 1 Tax1 protein from HTLV-2 Tax2" pps

Báo cáo y học:

Báo cáo khoa học

... equivalent expression of Tax2B and Tax300 in Jurkat cells (data not shown) [20] After processing from p100 into p52, the p52 protein next translocates from the cytoplasm into the nucleus and then either ... substitutions derived from Tax2B in the indicated regions in the backbone of Tax1 Jurkat cells were infected with lentiviruses encoding the indicated Tax or the mutant proteins The total cell lysate (B), ... Tax1 (B) CTLL-2 cells were infected with lentiviruses encoding the indicated Tax proteins in the presence of IL-2 At 48 hours after infection, the cells (1 × 103, × 103, and × 104 cells/well) were...
  • 11
  • 88
  • 0

Báo cáo y học: "inferring steady state single-cell gene expression distributions from analysis of mesoscopic samples" docx

Báo cáo y học:

Báo cáo khoa học

... genes in epithelial cells derived from the human SW620 colon cancer cell line Cells were harvested from two plates of cell culture that each contained approximately × 107 cells For the first ... (a) plat e of ~1 x cells ce ll s 10 s a m p l e s o f 1x10 1x1 cells 1x1 10 s a m p l e s o f 1x10 cells 10 s a m p l e s o f 1x1 1x10 cells 10 s a m p l e s o f 1x1 1x10 cells (b) 120 m g o ... only been a single published report of the variability of gene expression in single cells, which did not provide an underlying statistical model for mRNA representation within the cell [1] While...
  • 12
  • 88
  • 0

Tài liệu Báo cáo khoa học: Functional characterization of an orphan cupin protein from Burkholderia xenovorans reveals a mononuclear nonheme Fe2+-dependent oxygenase that cleaves b-diketones ppt

Tài liệu Báo cáo khoa học: Functional characterization of an orphan cupin protein from Burkholderia xenovorans reveals a mononuclear nonheme Fe2+-dependent oxygenase that cleaves b-diketones ppt

Báo cáo khoa học

... Functional annotation of cupin proteins from sequence and 3D structural data alone is a challenging task [7], as reflected by the recent addition of several new protein structures (Protein Data Bank identifiers ... (CDO) (Protein Data Bank identifier: 2ATF) [20], ARD (Protein Data Bank identifier: 1VR3) [21], QDO (Protein Data Bank identifiers: 1Y3T and 1JUH) [11,12], gentisate 1,2-dioxygenase 5984 (Protein ... characterized cupin protein from Rubrivivax gelatinosus PM1 (Protein Data Bank identifier: 2O1Q) that has been functionally annotated as acetyl ⁄ propionyl-CoA carboxylase (RgCarb) The three proteins share...
  • 15
  • 234
  • 0

Tài liệu Báo cáo khoa học: Structure of the putative 32 kDa myrosinase-binding protein from Arabidopsis (At3g16450.1) determined by SAIL-NMR docx

Tài liệu Báo cáo khoa học: Structure of the putative 32 kDa myrosinase-binding protein from Arabidopsis (At3g16450.1) determined by SAIL-NMR docx

Báo cáo khoa học

... 299-residue protein with unknown structure At3g16450.1 has been classified as a myrosinase-binding protein- like protein Myrosinase is a glucosinolatedegrading enzyme [4], and myrosinase-binding protein ... structure of a myrosinase-binding protein At3g16450.1N AQKVEAGGGAGGASWDDG-VHDGVRKVHVGQGQDGVSSINVVYAKDSQDVEGGEHGKKTL At3g16450.1C MBPfromB.napus1-125 MBPfromB.napus194-336 MBPfromB.napus356-498 At1g52030.2-154 ... Galb1-4(Fuca1-3)GlcNAcb13Galb1-4Glc were purchased from Calbiochem (San Diego, CA, USA) Cellohesaose, chitohesaose, isomaltohexaose, laminarihesaose and maltohexaose were purchased from Seikagaku Kogyo Co The protein At3g16450.1...
  • 12
  • 184
  • 0

Tài liệu Báo cáo khoa học: Crystal structure of the BcZBP, a zinc-binding protein from Bacillus cereus doc

Tài liệu Báo cáo khoa học: Crystal structure of the BcZBP, a zinc-binding protein from Bacillus cereus doc

Báo cáo khoa học

... BcZBP with related proteins BcZBP shares significant sequence similarities with the two proteins of known structure from the Pfam02585 family (Fig 6), namely TT1542 (1UAN.pdb) from Thermus thermophilus ... the N-acetylglucosamine moiety Only two proteins of the family have been structurally characterized to date: TT1542 from Thermus thermophilus [7] and MshB from Mycobacterium tuberculosis [8,9], ... identity, at the amino acid level The protein encoded by bc1534 is classified as a LmbE-related protein and hereafter will be referred to as BcZBP (B cereus zinc-binding protein) The N-terminal part of...
  • 11
  • 219
  • 0

Tài liệu Báo cáo khoa học: Steady-state and time-resolved fluorescence studies of conformational changes induced by cyclic AMP and DNA binding to cyclic AMP receptor protein from Escherichia coli ppt

Tài liệu Báo cáo khoa học: Steady-state and time-resolved fluorescence studies of conformational changes induced by cyclic AMP and DNA binding to cyclic AMP receptor protein from Escherichia coli ppt

Báo cáo khoa học

... were purchased from Sigma cAMP and dithiothreitol were from Fluka The Fractogel EMD SO3 650 (M) was from Merck, and Q-Sepharose Fast Flow, Sephacryl S-200 HR and Sephadex G-25 were from Amersham ... receptor protein from Escherichia coli J Biochem 266, 545552 14 Wasylewski, M., Maecki, J & Wasylewski, Z (1995) Fluorescence study of Escherichia coli cyclic AMP receptor protein J Protein Chem ... shown that the ligand binding mediates changes in the protein conformation It is believed that these changes allow the protein molecule to switch from the low-afnity and nonspecic DNA-binding state...
  • 11
  • 153
  • 0

Tài liệu Báo cáo Y học: Functional analysis of a small heat shock/a-crystallin protein from Artemia franciscana docx

Tài liệu Báo cáo Y học: Functional analysis of a small heat shock/a-crystallin protein from Artemia franciscana docx

Báo cáo khoa học

... in 12.5% polyacrylamide gels, blotted to nitrocellulose and probed with antibody to p26 by the ECL procedure Lane 1, lg of cell free extract protein from Artemia cysts; 2, p26-full; 3, p26-ND36; ... with other proteins, whereas full-length p26 in cell free extracts from E coli and Artemia Bacteria transformed with p26 containing constructs demonstrated greater thermotolerance than cells that ... ll of extract from E coli BL21(DE3) transformed with p26 cDNA cloned in pET21(+) and 400 lL of cell free extract from Artemia cysts were centrifuged in sucrose gradients Samples from gradient...
  • 10
  • 165
  • 0

Báo cáo khoa học: Global shape and pH stability of ovorubin, an oligomeric protein from the eggs of Pomacea canaliculata pot

Báo cáo khoa học: Global shape and pH stability of ovorubin, an oligomeric protein from the eggs of Pomacea canaliculata pot

Báo cáo khoa học

... on the protein is available [11,13,19–24] It is evident from these studies that the molluskan ovorubin complex differs in properties and molecular features from the crustacean carotenoprotein ... molluskan carotenoprotein so far studied shows structural stability over a wider pH range than that of the crustaceans or echinoderm proteins Remarkably, ovorubin is the only carotenoprotein stable ... made in mm optical path length quartz cells placed in a thermostated cell holder kept at 20 °C Each spectrum was corrected for buffer fluorescence and averaged from at least two independent runs...
  • 9
  • 144
  • 0

Báo cáo khoa học: Solution structure of the catalytic domain of RICH protein from goldfish pot

Báo cáo khoa học: Solution structure of the catalytic domain of RICH protein from goldfish pot

Báo cáo khoa học

... CNP2 in glial and non-glial cells Mol Cell Neurosci 31, 446–462 Bernales S, Papa FR & Walter P (2006) Intracellular signaling by the unfolded protein response Annu Rev Cell Dev Biol 22, 487–508 ... was prepared from cells grown on minimal M9 media containing 15N ammonium chloride and 13C glucose (Cambridge Isotopes Laboratory, Andover, MA, USA) The N-terminal His-tag was cleaved from RICH ... fusion protein at room temperature Benzamidine sepharose and Ni2+-loaded chelating sepharose were used to remove thrombin and the His-tag peptide from RICH The resulting 222 amino acid protein...
  • 10
  • 112
  • 0

Báo cáo khoa học: The Rieske protein from Paracoccus denitrificans is inserted into the cytoplasmic membrane by the twin-arginine translocase doc

Báo cáo khoa học: The Rieske protein from Paracoccus denitrificans is inserted into the cytoplasmic membrane by the twin-arginine translocase doc

Báo cáo khoa học

... of Rieske proteins Experimental procedures Bioinformatic tools Protein sequences were obtained from Swiss-Prot protein database (; (a) bacterial Rieske proteins: R ... promotor Subcellular fractionation To analyse Tat-dependent translocation, subcellular localization of the Rieske protein variants was determined Subcellular fractionation of P denitrificans cells was ... Bachmann et al Rieske protein from Paracoccus denitrificans Fig The [2Fe)2S] cluster is inserted into the Rieske apoprotein in the cytoplasm EPR spectra of: I, purified Rieske protein fragment (ISF);...
  • 14
  • 140
  • 0

Báo cáo khoa học: Structural and functional roles for b-strand 7 in the a-crystallin domain of p26, a polydisperse small heat shock protein from Artemia franciscana pdf

Báo cáo khoa học: Structural and functional roles for b-strand 7 in the a-crystallin domain of p26, a polydisperse small heat shock protein from Artemia franciscana pdf

Báo cáo khoa học

... the study to p26 from Artemia and transfected mammalian cells lacking these residues indicated that they had almost no effect on structure and function Cellfree extracts prepared from transformed ... the cytoplasm and nuclei of transfected cells, although some nuclei lacked the protein (not shown) p26 was subsequently prepared from transfected COS-1 cells for determination of oligomer size ... mammalian and bacterial cells, and oligomerization is unaffected by protein purification, observations important for subsequent analysis of the protein in in vitro assays Single- site mutations to...
  • 15
  • 249
  • 0

Báo cáo khoa học: Solution structure of the active-centre mutant I14A of the histidinecontaining phosphocarrier protein from Staphylococcus carnosus ppt

Báo cáo khoa học: Solution structure of the active-centre mutant I14A of the histidinecontaining phosphocarrier protein from Staphylococcus carnosus ppt

Báo cáo khoa học

... + j; j ‡ 5) F dihedral angles from 3J couplings (MOCCA-SIAM) Hydrogen bonds from H(N)CO experiment RDCs N 15 H - N RDC from IPAP/HSQC experiments N a H - H RDC from MOCCA-SIAM experiments Total ... could be determined from HSQC, HNCA, HNCO and CBCA(CO)NH spectra recorded at 600 MHz Distance restraints were derived from homonuclear 2D NOESY spectra in 1H2O and 2H2O and from a 13C resolved ... the wild-type HPr from S carnosus its structure was recalculated employing exactly the same protocol as for the mutant protein Mean structures of the mutant and wild-type HPr proteins were calculated...
  • 10
  • 187
  • 0

Báo cáo khoa học: Fluorescence quenching and kinetic studies of conformational changes induced by DNA and cAMP binding to cAMP receptor protein from Escherichia coli ppt

Báo cáo khoa học: Fluorescence quenching and kinetic studies of conformational changes induced by DNA and cAMP binding to cAMP receptor protein from Escherichia coli ppt

Báo cáo khoa học

... binding sites involves a sequence of protein conformational changes, which shift the protein from a low-afnity nonspecic DNA-binding protein to a state of the protein that binds DNA with FEBS Journal ... mutants of cAMP receptor protein from Escherichia coli J Biol Chem 278, 4302043026 Baszczyk U, Polit A, Guz A & Wasylewski Z (2002) Interaction of cAMP receptor protein from Escherichia coli with ... cyclic 3Â,5Â-monophosphate receptor protein from Escherichia coli Biochemistry 19, 51245130 42 Gill SC & von Hippel PH (1989) Calculation of protein coefcients from amino acids sequence data Anal...
  • 14
  • 133
  • 0

Báo cáo khoa học: Pulchellin, a highly toxic type 2 ribosome-inactivating protein from Abrus pulchellus Cloning, heterologous expression of A-chain and structural studies ppt

Báo cáo khoa học: Pulchellin, a highly toxic type 2 ribosome-inactivating protein from Abrus pulchellus Cloning, heterologous expression of A-chain and structural studies ppt

Báo cáo khoa học

... resulting in cell death due to protein synthesis arrest [9] The B-chain has lectin properties, preferentially binding to galactosyl-terminated glycoproteins on the surface of eukaryotic cells leading ... was used to produce soluble recombinant fusion protein with the predicted molecular mass ( 60 kDa) (Fig 2A) The fusion protein was puried from the cell lysate by afnity chromatography on a glutathioneSepharose ... lanes and 3, total proteins from E coli AD 202pGEX-rPAC not induced and induced by 0.4 mM isopropyl thio-b-D-galactopyranoside, respectively; lane 4, soluble fraction from cellular lysates after...
  • 10
  • 160
  • 0

Báo cáo khoa học: A DmpA-homologous protein from Pseudomonas sp. is a dipeptidase specific for b-alanyl dipeptides Hidenobu Komeda and Yasuhisa Asano docx

Báo cáo khoa học: A DmpA-homologous protein from Pseudomonas sp. is a dipeptidase specific for b-alanyl dipeptides Hidenobu Komeda and Yasuhisa Asano docx

Báo cáo khoa học

... deduced from bapA was similar to those of hypothetical protein PA1486 from Pseudomonas aeruginosa PAO1 [17], putative d-aminopeptidase PP3844 from Pseudomonas putida KT2440 [18], hypothetical protein ... BapA from Pseudomonas sp MCI3434; PA1486, hypothetical protein PA1486 from P aeruginosa PAO1; PP3844, putative D-aminopeptidase PP3844 from P putida KT2440; Atu5242, aminopeptidase Atu5242 from ... Komeda and Y Asano b-Ala-Xaa dipeptidase from Pseudomonas sp Table Purification of BapA protein from E coli JM109 harboring p2DAPEX Total protein (mg) Cell- free extract Ammonium sulfate DEAE-Toyopearl...
  • 10
  • 143
  • 0

Báo cáo khoa học: GHP, a new c-type green heme protein from Halochromatium salexigens and other proteobacteria potx

Báo cáo khoa học: GHP, a new c-type green heme protein from Halochromatium salexigens and other proteobacteria potx

Báo cáo khoa học

... iron-sulfur protein [7], but there are some interesting proteins not previously characterized from A vinosum or other members of the Chromatiaceae, such as the photoactive yellow protein [8] ... mode with horse cytochrome c as internal calibrant Peptides from the tryptic and Glu-C endoproteinase digestion on apoprotein and native protein, respectively, were separated on a Pep-S II C2 ⁄ ... and a UV monitor set at 220 nm (all parts from Dupont, Wilmington, DE, USA) The generated peptides from the Asp-N endoproteinase digestion on the apoprotein were purified on a Brownlee PTC-C18...
  • 11
  • 178
  • 0

Xem thêm

Nạp tiền Tải lên
Đăng ký
Đăng nhập