0

sharon goldwater and thomas l griffiths and mark johnson

Tài liệu Báo cáo khoa học: L-Arabinose transport and catabolism in yeast doc

Tài liệu Báo cáo khoa học: L-Arabinose transport and catabolism in yeast doc

Báo cáo khoa học

... transporter.AbbreviationsAR, L- arabinose reductase; LAD, L- arabitol-4-dehydrogenase; LXR, L- xylulose reductase; PYCC, Portuguese Yeast Culture Collection;XDH, xylitol dehydrogenase; XK,D-xylulose kinase; XR, D-xylose ... diameter) and the l- ter washed twice with 10 mL ice-cold demineralized water.The filter was then transferred to a scintillation vial con-taining 6 mL liquid-scintillation cocktail Wallac OptiPhase‘HiSafe’ ... degra-dation involves two additional redox reactions ascompared with d-xylose metabolism (Fig. 1). l- arabitolis oxidized to l- xylulose by an l- arabitol 4-dehydroge-nase, and l- xylulose is converted...
  • 12
  • 647
  • 0
Tài liệu How To Close every sale By Joe Girard and roBerT l. sHook ppt

Tài liệu How To Close every sale By Joe Girard and roBerT l. sHook ppt

Tiếp thị - Bán hàng

... the nal major close. For example, • “Would you like to handle the payments monthly, quarterly or annually?”• “Is it okay to use your home address for the billing?”• “Would you spell your ... exactly that.Enthusiastically,Closing a sale is the stage in the selling process where salespeople meet the greatest diculty. Joe Girard walks the reader through fundamental selling principles ... about.Be a good listenerOutstanding salespeople are excellent listeners. A professional salesperson understands how the prospect thinks and feels by listening.Page 3SUMMARIESSUCCESSBibliographic...
  • 7
  • 470
  • 0
Educating the Net Generation by Diana G. Oblinger and James L. Oblinger, Editors ppt

Educating the Net Generation by Diana G. Oblinger and James L. Oblinger, Editors ppt

Quản trị mạng

... ideally should be relatively up to date and able to provide students with not only fundamental skills but also the chance to learn intermediate and advanced skills as the “cool new thing” rolls ... Neomillennial Learning Styles: Implications for Investments in Technology and Facultyby Chris Dede, Harvard University• How Emerging Media Foster Neomillennial Learning Styles • Conclusion ... records, and letters from soldiers and their families constitute the original source material that allows students to engage in “first-person learning.” The site also serves formal and informal learners....
  • 264
  • 517
  • 0
Báo cáo khóa học: Membrane transport of fatty acylcarnitine and free L-carnitine by rat liver microsomes pot

Báo cáo khóa học: Membrane transport of fatty acylcarnitine and free L-carnitine by rat liver microsomes pot

Báo cáo khoa học

... reticulum membrane.Mol. Biol. Cell. 11, 3675–3687.17. Polokoff, M.A. & Bell, R.M. (1978) Limited palmitoyl-CoA penetration into microsomal vesicles as evidenced by ahighly latent ethanol acyltransferase ... a cytosolically orientedDGAT, has been described [5–7]. This latent DGAT maybe involved in the reassembly of triacylglycerols whichlipidate very low density lipoprotein (VLDL) particles aspart ... theendoplasmic reticulum. Missing links in the VLDL story? Adv.Exp Medical Biol. 466, 59–67.13. Joyce, C., Skinner, K., Anderson, R.A. & Rudel, L. L. (1999) Acyl-coenzyme A: cholesteryl acyltransferase...
  • 8
  • 378
  • 1
Searchlights on Health by B. G. Jefferis and J. L. Nichols pptx

Searchlights on Health by B. G. Jefferis and J. L. Nichols pptx

Sức khỏe giới tính

... boon and a blessing tothousands who consult itspages. The world is full ofignorance, and the ignorant willalways criticise, because theylive to suffer ills, for they knowno better. New light ... Pain,page 304Solemn Lessons forParents, page 312Ten Health Rules for Babies
  • 2,269
  • 727
  • 0
Searchlights on Health: Light on Dark Corners, by B.G. Jefferis and J. L. Nichols doc

Searchlights on Health: Light on Dark Corners, by B.G. Jefferis and J. L. Nichols doc

Sức khỏe giới tính

... whowalk much with the lame, who havelearned to walk with a hitch or limp liketheir lame friends. Vice stalks in thestreets unabashed, and children copy it.5. Live with the Culpable.—Live ... withthe culpable, and you will be very likelyto die with the criminal. Bad company islike a nail driven into a post, which afterthe first or second blow, may be drawnout with little difficulty; ... Fatal.—Beginwell, and the habit of doing well willbecome quite as easy as the habit ofdoing badly. "Well begun is half ended,"says the proverb; " ;and a good beginningis half...
  • 1,510
  • 813
  • 0
Neurodegeneration Edited by L. Miguel Martins and Samantha H.Y. Loh pot

Neurodegeneration Edited by L. Miguel Martins and Samantha H.Y. Loh pot

Sức khỏe giới tính

... 93 Carla Caruso, Lila Carniglia, Daniela Durand, Teresa N. Scimonelli and Mercedes Lasaga Chapter 7 Mechanisms and Patterns of Axonal Loss in Multiple Sclerosis 121 Zachary M. Harris and Jacob ... resulting from the metal-peptide interactions. In performing these simulations carrying them out in biologically relevant time scales will be a challenge that will need to be met. It will also ... Rh and Ir solvato-complexes contain 2-phenyl pyridine, benzoquinoline, or phenyl quinoline ligands. Presumably, the labile solvent (H2O) molecules are displaced by the histidine imidazoles...
  • 374
  • 242
  • 0
SMALL IS BEST LESSONS FROM ADVANCED ECONOMIES RYAN BOURNE AND THOMAS OECHSLE potx

SMALL IS BEST LESSONS FROM ADVANCED ECONOMIES RYAN BOURNE AND THOMAS OECHSLE potx

Cao đẳng - Đại học

... Finland, France, Germany, Greece, Hong Kong, Iceland, Ireland, Israel, Italy, Japan, Korea, Luxembourg, Malta, Netherlands, New Zealand, Norway, Portugal, Singapore, Slovak Republic, Slovenia, ... analysis are: Australia, Austria, Belgium, Canada, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Iceland, Ireland, Israel, Italy, Japan, Luxembourg, Netherlands, New Zealand, ... Kong Ireland Japan Korea Singapore Spain Switzerland Taiwan US Austria Belgium Canada Cyprus Czech Republic Denmark Finland France Germany Greece Iceland Israel Italy Luxembourg...
  • 20
  • 419
  • 0
Asthma WellnessKeeping Children with Asthma in School and Learning Liability & Litigation: A Legal Primer Asthma & Indoor Air Quality (IAQ)Asthma Management, Policies and Procedures.St r a i g h tBy Paul D. Houstont a l kIn School and Healthy: docx

Asthma WellnessKeeping Children with Asthma in School and Learning Liability & Litigation: A Legal Primer Asthma & Indoor Air Quality (IAQ)Asthma Management, Policies and Procedures.St r a i g h tBy Paul D. Houstont a l kIn School and Healthy: docx

Sức khỏe giới tính

... district-wide guidelines and protocolsapplicable to chronic illnessesgenerally and specific protocolsfor asthma and other commonchronic illnesses of students. Dr.Howard Taras, medical consult-ant ... illness compensation bill. ■students the right to carry and use asthma inhalers at schoolLegal checklist• Know the law and be proac-tive in following it.• Ensure you have policies inplace ... Indoor Air Quality (IAQ)Children are especially vul-nerable to the adversehealth effects of indoorpollutants and allergens—moreso than adults. Students withasthma are particularly at risk(GAO,...
  • 16
  • 450
  • 0
The Persian Gulf in the Coming DecadeTrends, Threats, and OpportunitiesDaniel L. Byman • John R. Wise pptx

The Persian Gulf in the Coming DecadeTrends, Threats, and OpportunitiesDaniel L. Byman • John R. Wise pptx

Cao đẳng - Đại học

... personnelusually are not as reliable or loyal as nationals. Most regional mili-taries try to ensure that nationals instead of foreigners staff their eliteunits, but any major engagement will involve ... involve other units as well.Nor are the Gulf state forces particularly skilled. Regional landforces’ maneuver capabilities are poor. Their operational plans havegenerally been designed for static ... hasdeclined in the Gulf. The death of the charismatic AyatollahKhomeini, and his replacement by the uninspiring and intellectuallysecond-rate Ayatollah Khamene’i, has cooled the ardor of many Gulfcitizens....
  • 94
  • 207
  • 0
Báo cáo khoa học: Characterization of L-aspartate oxidase and quinolinate synthase from Bacillus subtilis potx

Báo cáo khoa học: Characterization of L-aspartate oxidase and quinolinate synthase from Bacillus subtilis potx

Báo cáo khoa học

... NADA_SALTY LLEAPTAGEG ATCRSCAHCPWMAMNGLKAIAEGLEQGGAA HEIQVDAALREGALLPLN 336 NADA_BACSU QIESLN PDMCPCLTMNRIDLPHLLWSLEQIEKGEP SGVIKVPKAIQEDALLALN 362 NADA_HELPY NTFILS STLALCPTMNETTLKDLFEVLKAYKNHRA ... MSILDVIKQSNDMMPESYKELSRKDMETRVAAIKKKFGSRLFIPGHHYQKDEVIQFADQTG DSLQLAQVAEKNKE ADYIVFCGVHFMAETADMLTSEQ 98 NADA_HELPY MPTDNDLKAAILELLRDLDVLLVAHFYQKDEIVELAHYTG DSLELAKIASQS-D KNLIVFCGVHFMGESVKALAFDK 76 NADA_METTH MLNQLQRDILRLKKEKNAIILAHNYQSREIQEIADFKG ... TTRA-RQVLVATEVGMLHQLRRAAPEVD 290 NADA_ATHAL HSLDSIKSLLPRLHYFQEGTCIVHHLFGHEVVERIKYMYCDAFLTAHLEVPG EMFSLAMEAKKREMGVVGSTQNILDFIKQKVQEAVDRNVDDHLQFVLGTESGMVTSIVAVIRSLL 355 NADA_OSATI HNKKSINALLPRLHYYQDGNCIVHDMFGHEVVDKIKEQYCDAFLTAHFEVPG...
  • 18
  • 350
  • 0
Báo cáo khoa học: DNA-binding and transcription characteristics of three cloned sigma factors from mustard (Sinapis alba L.) suggest overlapping and distinct roles in plastid gene expression doc

Báo cáo khoa học: DNA-binding and transcription characteristics of three cloned sigma factors from mustard (Sinapis alba L.) suggest overlapping and distinct roles in plastid gene expression doc

Báo cáo khoa học

... three cloned sigmafactors from mustard (Sinapis alba L. ) suggest overlapping and distinct roles in plastid gene expressionAnke Homann and Gerhard LinkPlant Cell Physiology and Molecular Biology, ... cDNA library [14].Clones pAD/3C1Sig2 and pAD/4B2Sig3 contained thefull-length SaSig2 and SaSig3 cDNAs, respectively.Correspondence to G. Link, Plant Cell Physiology and MolecularBiology, ... (lanes 2 and 3), and full reactions (labelled DNA plus core plus sigma) incubated with unlabelled excess competitor DNAs (lanes 12–16).The latter were either the promoter-less fragment Bam0.5 (lanes...
  • 13
  • 304
  • 0

Xem thêm