sample of a pr campaign plan

... effectiveness of a PR campaign? Find out at How to Plan a PR Campaign. How to Plan a PR Campaign is an intensive two-day seminar designed to show communications professionals how to plan, implement and ... should a really top notch PR plan contain? What do the professionals include? This session takes you thr ough all the critical stages of planning a PR campaign: ã The essential stages of planning a ... W rite a PR Plan What should a PR plan look like? What should it say? This session explains the practicalities of sitting down and writing a full-blown PR campaign: ã How to write a PR plan a step-by-step...

... addition to the traditional array of print and broadcast sources, for dissemination of news and information. Every organization should have a program to stay in touch regularly with appropriate ... In addition to an ongoing public relations campaign it may be necessary to reach out to head off any negative publicity caused by lack of accurate information. Examples of appropriate use of ... transparencies. Press packages may include black-and-white photos and state that color material also is available via your Web site’s press section. Audio Tapes for Radio Audio tapes are rarely used, but can...

... Kaats GR was the principal investigator; he se- cured and audited all study data, conducted all of the statistical analyses, and contributed significantly to the preparation and submission of ... following all three plans had an increase in MAPC: Plan 1=1.30%, Plan 2=2.00%, and Plan 3=4.1%. Using a repeat- ed-measures t-test, the MAPC from baseline in all three Plans was significant (P=0.003, ... Subjects in all three plans had an increase in MAPC: Plan 1=1.20%, Plan 2=0.33%, and Plan 3=2.5%. Using a repeated measures t-test, MAPC in Plan 1 and 3 were significant (P=0.027 and P=0.002...

... advance for management of the crisis and the primary goal of this strategy should be the protection of participants, spectators and participating institutions. Having a strategy set in advance ... organizations and interest groups are "battling" for space or airtime. Press Releases Press releases help inform media of team-related news and events and can serve as a summary prior ... enter the data in and analyze if you have access to SPSS. If you do not have access to SPSS, the data can also be converted to other data analysis programs by your campus research department....

... services providers seem to competed by value added services Advertising and PR campaign Advertising and PR campaign Media Media For For MCA service and MCA service and MobiFone MobiFone WEAKNESSES  ... Its automatically. Media Ads PR Creative Marketing Strategy Creative Creative For For MCA service and MCA service and MobiFone MobiFone MARKETING Strategies: ִUndertake TET promotion program: ... Strategy Marketing Strategy For For MCA service and MCA service and MobiFone MobiFone PR campaign PR campaign For For MCA service and MCA service and MobiFone MobiFone STRENGTHS  One of the...

... aa 208 aa 24 aa BamH 34 aa Start Stop Xho1 N -Pro Protease domain Protease domain CT - ex 380 aa 1 II NP 114 aa 208 aa BamH1 34 aa Start Stop Xho1 SS SS G SSS S N-Pro 356 aa III MSTLFII S ILLFLAS F SYAMDI S TIEYKYDKSS AWRTDEEVKEIYELWLAKHDKVY SG LVEYEKRFEIFKDNLKFIDEH NSENHTYKMGLTPYTDLTNEEFQAIYLGTRSDTIHRLKRTINISERYAYEAGDNLPEQIDWRKKGAVTPVKNQGKCG SCWAFSTVSTVESINQIRTGNLISLSEQQLVDCNKKNHG CKGGAFVYAYQYIIDNGGIDTEANYPYKAVQGPCRAAK KVVRIDGYKGVPHCNENALKKAVASQPSVVAIDASSKQF QHYKSGIFSGPCGTKLNHGVVIVGYWKDYWIVRNSW GRYWGEQGYIRMKRVGGCGLCGIARLPYYPTKA AGDENSKLETPELLQWSEEAFPLA IV A B 66 ... rmErv-C +CT . Because Erv-C isolated from the latex of the same plant does not show the CT-extension, the possibility 19 aa 114 aa 208 aa 24 aa Pre N-Pro Protease domain CT - ex 365 aa H1 I N Pro CT ex 114 aa 208 ... Nakamura K & Matsuoka K (1993) Protein targeting to the vacuole in plant cells. Plant Physiol 101, 1–5. 10 Okamoto T, Yuki A, Mitsuhashi N & Mimamikawa T (1999) Asparaginyl endopeptidase...

... QuikChange site-directed mutagenesis kit (Stratagene, La Jolla, CA, USA). Plasmid pET-1TK was used as template and Kleb(HtoA)fw (5Â-GCTTAGCCGCGCCGGCATTCG) and Kleb(HtoA)rv (5Â-CGAATGCCGGCGCGGCTAAGC) ... groups of HAPs are adapted to different habitats. To support plant growth, bacteria do not need to release phosphate as fast as the diges- tive tract of an animal host, where possible substrates might ... similarity, the overall structure of Klebsiella phytase bears similar- ity to other histidine-acid phosphatases, such as E. coli phytase, glucose- 1-phosphatase and human prostatic-acid phosphatase....

... oxyheme appeared at 540 and 579 nm. Then, a broad band appeared at around 660 nm, and was maximal 9–12 min after initiation of the reaction. The spectral features of the final reaction mixture were analogous, ... the axial heme ligand in rat heme oxygenase-1. Arch Biochem Biophys 317, 253–258. 21 Chu GC, Katakura K, Tomita T, Zhang X, Sun D, Sato M, Sasahara M, Kayama T, Ikeda-Saito M & Yoshida T ... coli. Plant Physiol 97, 1495–1401. 40 Onda Y, Matsumura T, Kimara-Ariga Y, Sakakibara T, Sugiyama T & Hase T (2000) Differential interaction of maize root ferredoxin:NADP + oxidoreductase with photosynthetic...

... status, and clinical variables such as cancer stage at diagnosis, time after diagnosis, and initial treat- ment. All measures will be collected at the beginning of the trial, and at 6, 12, 18 and ... Providing information that i s congruent with a patient ’sneedsat that particular time is an important determinant for patient satisfaction and affects health-related quality of life (HRQoL) and anxiety and ... sum- marize characteristics of both hospitals and patients. Characteristics of patients (i.e ., age, type of cancer, stage, treatment, so cio-economic status, marital statu s, educational level,...

... Sessentaidosossemcompro- metimentocognitivo(39mulherese21homens),comidadede69,96,3anosecomescolaridadede8,55,5 anos,foramincluớdosnoestudo.TodosforamsubmetidosaoMini-ExamedoEstadoMental(MEEM)eEscala deDepressóodeCornellparaexclusóo,respectivamente,decomprometimentocognitivoglobalededepressóo. TambộmresponderamaoMAC-Q,questionỏrioelaboradoparaavaliaraimpressóosubjetivadofuncionamento damemúria.Posteriormente,elesforamsubmetidosaostestesextensóodedớgitosemordemdiretaeinversa, BateriaBrevedeRastreioCognitivoeBateriadeAvaliaỗóoFrontal.Resultados: ... 2008;2(1):42-45 Memory loss is one of the most common complaints  arising in consultations with elderly people, being reported  by 25% to 50% of these individuals. 1  However, whether  these subjective memory complaints (SMC) are related to  objective memory deficits or to subsequent development  of dementia, remains a matter of debate. A recent review found that SMCs are not consistently  associated with current cognitive impairment, but rather  are associated with a greater risk of future cognitive de- cline. 2  Indeed, the diagnosis of mild cognitive impairment  (MCI), which entails an increased likelihood of conversion  to dementia, demands the existence of SMCs, preferably  confirmed by an informant. 3 High age, female gender and low educational level are  generally associated with a higher prevalence of memory  complaints. 1  In an autopsy study, SMCs were found to be  related to the presence of Alzheimer’s disease (AD) pathol- ogy in elderly with and without dementia, suggesting that  memory complaints in older persons may be a sign of self  awareness of a degenerative process. 4 However, SMCs might also be related to depression and  some personality traits, such as neuroticism. 2  It is also pos- sible that these complaints vary according to the culture of the people studied. In a recent Brazilian study, Minett et  al. found that subjects with and without SMCs performed  similarly in a series of cognitive tests, although the former  had higher scores on the Geriatric Depression Scale. 5 The present study aimed to further investigate this topic  in a group of cognitively healthy Brazilian elderly subjects  which were divided into two subgroups according to the  presence of SMCs and submitted to brief cognitive tests. Methods Sixty cognitively intact elderly individuals (39 females  and 21 males), aged 69.9±6.3 years (ranging from 60 to 91  years), and with mean educational level of 8.5±5.5 years  (ranging from 1 to 20 years), were included in the study.  These individuals were family caregivers of demented pa- tients followed at the Behavioral and Cognitive Neurology  Unit of the Faculty of Medicine of the Federal University  of Minas Gerais, in Belo Horizonte (MG), Brazil, and also  volunteers recruited from the community. Inclusion criteria were absence of neurological or psy- chiatric diseases according to a clinical interview, absence  of depression (see below), and no use of benzodiazepines,  antidepressants or neuroleptics.  All participants were submitted to the Mini-Mental  State-Examination (MMSE) 6,7  and to the Cornell scale of depression. 8,9  Performance on the MMSE was adjusted for  educational level and had to be greater than or equal to 21  for 1-3 years of schooling, greater than or equal to 24 for  4-7 years and greater than or equal to 26 for individuals  with 8 or more years of schooling. 10  Scores on the Cornell  scale of depression had to be less than or equal to 7 points  in order to rule out depression. 8 Cognitive evaluation was carried out with the follow- ing tests: the Brief Cognitive Screening Battery (BCSB) 11,12 ,  digit span forward and backward and the Frontal Assess- ment Battery (FAB). 13,14  The BCSB includes a memory test  of 10 simple figures and yields different scores, namely:  incidental and immediate memory, learning, delayed recall  and recognition. 15,16  The battery also includes a category  fluency test (animals per minute) and clock drawing and  has proven very sensitive in the diagnosis of mild AD. 12  The  FAB is a brief diagnostic instrument for the assessment of executive functions in patients with suspected frontal lobe  syndrome. 13 All individuals were given a structured self-report  memory questionnaire, the MAC-Q. 17  This questionnaire  was devised to assess age-related memory decline. It is  composed by six questions related to memory function- ing in everyday situations (e.g., to remember a telephone  number that he/she uses at least once a week) in which  the subject is asked to compare and rate his/her current  ability to when he/she was 40 years’ old. The total score on  the MAC-Q ranges from 7 to 35, where greater scores in- dicate subjective memory loss. Scores greater than or equal  to 25 have been found to be suggestive of age-associated  memory impairment. Accordingly, in the present study,  the individuals were divided into two groups: absence of SMCs (MAC-Q scores <25) and presence of SMCs (MAC- Q scores ≥25). The performance of the two groups on the  different cognitive tests was compared. One of the authors administered the MMSE, the Cor- nell scale and the MAC-Q. Subsequently, the other inves- tigator, blinded to the subjects’ results for these three mea- sures, administered the cognitive evaluation. Descriptive analysis of the data and statistical compari- sons between the performances of the two groups on the  different cognitive tests were carried out with MedCalc  software. Student’s t-test was used for comparison of age,  educational level and MMSE scores, as well as for the results  of the other cognitive tests (digit span, BCSB and FAB).  Chi-square was employed for comparing gender distribu- tion of the two groups. Level of significance was set at 0.05.  The study was approved by the Research Ethics ... Sessentaidosossemcompro- metimentocognitivo(39mulherese21homens),comidadede69,96,3anosecomescolaridadede8,55,5 anos,foramincluớdosnoestudo.TodosforamsubmetidosaoMini-ExamedoEstadoMental(MEEM)eEscala deDepressóodeCornellparaexclusóo,respectivamente,decomprometimentocognitivoglobalededepressóo. TambộmresponderamaoMAC-Q,questionỏrioelaboradoparaavaliaraimpressóosubjetivadofuncionamento damemúria.Posteriormente,elesforamsubmetidosaostestesextensóodedớgitosemordemdiretaeinversa, BateriaBrevedeRastreioCognitivoeBateriadeAvaliaỗóoFrontal.Resultados: Vinteseteidosostiveramescores <25noMAC-Qeforam,portanto,classicadoscomonóotendoqueixas,enquanto33tiveram>25pontosno questionỏrioeforamconsideradoscomotendoqueixas.Nóohouvediferenỗasentreosdoisgruposemrelaỗóo idade,gờnero,escolaridadeepontuaỗừesnoMEEM.Acomparaỗóoentreodesempenhodosidososcomesem queixasnosdiferentestestesnóoreveloudiferenỗassignicativas,emboratenhasidoobservadatendờnciapara queossemqueixastivessemmelhordesempenhodememúriaincidental.Conclusừes:...

... L, Hamid Q & Elias JA (2004) Acidic mammalian chitinase in asthmatic Th2 inflammation and IL-13 pathway activation. Science 304, 1678– 1682. 4 Kasprzewska A (2003) Plant chitinases ) regulation ... equal amounts of (GlcNAc) 3 and (GlcNAc) 2 ; the 80 : 20 anomeric ratio of the products indicates that cleavage after sugar 2 or sugar 3 occurs approxi- mately equally often. Structure The overall ... Bio-Rad Protein Assay Kit (Bio-Rad, Hercu- les, CA, USA) with BSA as a standard. Analyses of the specific activity against chitooligosaccha- rides were performed in 100 lL reaction mixtures con- taining...

... [e.g. cerato-platanin of Ceratocystis fimbriata f. sp. platani, Snodprot1 of Phaeosphaeria nodorum and Sp1 of Leptosphaeria maculans) or human allergens and path- ogenesis-related proteins (As-CG of ... several proprietary and public genomic databases using a tailor-made bioinformat- ics facility. The mascot search was run against all proteins and DNA sequence information from public databases V. ... conidia and hyphae of Ceratocystis fimbriata f. sp. Platani. FEMS Microbiol Lett 233, 341–346. 25 Pazzagli L, Cappugi G, Manao G, Camici G, Santini A & Scala A (1999) Purification, characterization,...

... (ATGGAGAACTCAGT GACCCAAGATGGTAT) and 70b R1 (AGAATTCTGAG GTTGAAGAAGCTAGTAA) primers, and 70b F2 (TACT ATCAGCAGAAGCAATGTGGTGATA) and 70b R2 (TTACTGAGATGTCTTGTTCTTGGAAATGT) primers for atrpa70b. As a control, A. thaliana ... (TGT AACCGAGATGGTCGGCAAC) and AtRPA7 0a- 3Â (AA CAGTCATCTTCACTCTTTGT); AtRPA70b-5Â (TTCAA CTTTGTACCCATTGAT) and AtRPA70b-3Â (TTCACCG CCATTATATACCTTA). These primers were used to obtain a fragment of 722 bp ... (AtRPA7 0a and AtRPA70b) A. thaliana was used for genetic analysis of the functions of OsRPA7 0a and OsRPA70b because it has closely rela- ted homologs (AtRPA7 0a and AtRPA70b, respectively) and because...

... (NR) was highly purified from cauli- flower (Brassica oleracea var. botrytis) extracts. The final preparationcontainedanacyl-CoAoxidaseandasecond protein of the plant nucleotide pyrophosphatase family. ... the amounts and concentrations of ATP and NADH used in standard GS and NR assays, respectively. Data are presented as mean ± SEM. Cofactor AMP generated (nmol) % cofactor hydrolysed to AMP None 0.4 – ATP ... oleracea var. botrytis) extracts. The final preparation contained an acyl-CoA oxidase and a second protein of the plant nucleotide pyrophosphatase family. Nucleotide pyrophosphatases belong to a family...

... histogram represent the AtZFP11 expression levels adjusted to a- tubulin across all samples. Units are given as number of AtZFP11 moleculesặ lg )1 of total RNA. Data represent an average of three ... adjacent to the ATG start codon and SacI downstream of the TAA stop codon for easy cloning in the forward and reverse primers, respectively (forward, 5Â-ctc gag ATG AAG AGA ACA CAT TTG GCA-3Â; ... (Promega Corporation). Twenty microli- ters of protoplast lysate was loaded into each well of a 96-well plate, and luciferase activity was measured in a plate V. S. Tavva et al. Improvement of EcR gene...