rotation by angle f
AN1045 implementing file IO functions using microchip’s memory disk drive file system library
... available for use 0001h 0001h Cluster is reserved 0002-FFEFh 0000 0002-0FFF FFEFh Points to next cluster in the file FFF0-FFF6h 0FFF FFF0-0FFF FFF6h Cluster is reserved FFF7h 0FFF FFF7h Cluster ... Cluster is bad FFF8h-FFFFh 0FFF FFF8h-0FFF FFFFh Last cluster of a file FIGURE 2: FAT CLUSTER CHAIN Contents of Data Clusters File FAT Values FAT Position Value 0003h FFFFh 0004h 0005h File → Cluster ... PROTECTED END=0x 5F END=0xFF END=0x1FF END=0x2FF END=0x3FF END=0x4FF END=0x5FF END=0x6FF END=0x8FF PROTECTED END=0xAFF PROTECTED END=0xBFF END=0xDFF END=0xEF3 END=0xEFF END=0xF 5F END=0xFFF PROTECTED...
- 44
- 980
- 0
File System and Disk Administration
... dev/device ftype parameters fs_freq fs_passno Chỉ device đợc mount /dir/to/mount Là th mục đợc mount tới th mục ftype Là kiểu hệ thống file Ví dụ dới Solaris ufs, dới Linux ext2, nfs cho NFS , swap ... Ví dụ file fstab dới Linux systems: # # Sample /etc/fstab file for a Linux machine # # Local mounts /dev/sda1 / ext2 defaults 1 /dev/sda2 /usr ext2 defaults 1 /dev/sda3 /usr/data ext2 defaults ... proc cho /proc file system parameters Là biến tuỳ chọn mount ứng với o option fs_freq Đợc sử dụng dump để xác định hệ thống file cần đợc dump fs_passno Đợc sử dụng chơng trình fsck để xác định...
- 10
- 521
- 0
File system and Disk Administration
... tạo hệ thống file cần thực bước sau: ỹ Chọn quyền hạn đĩa ỹ Tạo partition ỹ Tạo file system Mỗi loại UNIX có công cụ khác để tạo file system Thông thường dùng lệnh fdisk, format, fdformat, lệnh ... tạo file system Để tạo hệ thống file Linux dùng lệnh mke2fs (trong sun solaris dùng lệnh newfs), mkswap tạo swap file system Ví dụ mke2fs /dev/hda1 mkswap /dev/hda2 Mounting and unmounting file ... dev/device ftype parameters Chỉ device mount 75 fs_freq fs_passno Giới thiệu UNIX- Một số thao tác UNIX ỹ /dir/to/mount Là thư mục mount tới thư mục ỹ ftype Là kiểu hệ thống file Ví dụ Solaris ufs,...
- 10
- 322
- 0
File system and disk administration
... /dir/to/mount ftype parameters fs_freq fs_passno • dev/device Chỉ device mount • /dir/to/mount Là thư mục mount tới thư mục • ftype Là kiểu hệ thống file Ví dụ Solaris ufs, Linux ext2, nfs cho NFS , swap ... thích Ví dụ file fstab Linux systems: # # Sample /etc/fstab file for a Linux machine # # Local mounts /dev/sda1 / ext2 defaults 1 /dev/sda2 /usr ext2 defaults 1 /dev/sda3 /usr/data ext2 defaults 1 ... tạo Tạo File Systems: Sau tạo partition hệ thống file chưa sẵn sàng cho việc sử dung mà cần phải tạo file system Để tạo hệ thống file Linux dùng lệnh mke2fs (trong sun solaris dùng lệnh newfs),...
- 8
- 259
- 0
File and User Information Utilities
... a File $ ls -ld f* > list $ cat list -rw - melissao -rw - melissao -rw - melissao -rw - melissao -rw - melissao -rw - melissao -rw - melissao staff staff staff staff staff staff ... 09:52 fruit -rw - melissao staff 57 Mar 09:53 fruit2 -rw - melissao staff 218 Jul 15 16:47 feathers -rw - melissao staff 218 Jul 15 16:48 feathers_6 -rw - melissao staff 105 Oct 19 1998 file2 ... - melissao staff 1696 Oct 19 1998 file1 -rw - melissao staff 218 Oct 19 1998 file3 -rw - melissao staff 218 Jul 15 16:48 feathers_6 -rw - melissao staff 218 Jul 15 16:47 feathers -rw ...
- 18
- 385
- 0
Date and Time Manipulation
... case, before you perform the calculation, the values of Month and Year may need to be altered: for the months of January (1) and February (2), you must add 13 to Month and subtract from Year; for ... a certain time frame that you set This code would be called from another script, which actually performs the notifications Two sets of day and hour parameters (for a total of four) are passed ... number of days between two dates The valid dates for this equation (taken from the Gregorian calendar) range from October 15, 1582 to December 31, 9999 Dates outside this range (or dates from different...
- 6
- 368
- 0
Viewing a WSDL File and Testing a Web Service
... the one row from the Customers table with a CustomerID of ALFKI, as shown in Figure 17.5 Notice that the equals (=) and single quote (') characters in the whereClause parameter value of the URL ... to the codes %3D and %27 respectively Figure 17.5: Running the RetrieveCustomers() method with a whereClause of CustomerID= 'ALFKI' As you can see from Figure 17.5, the DataSet is returned as ... (see Figure 17.4) that you can use to test the RetrieveCustomers() method exposed by your Web service Figure 17.4: The Web service test page The test page contains a text box with a label of whereClause...
- 7
- 382
- 0
File and Registry Operations part 3
... đêm: while ((bytesRead = bufInput.Read(buffer, 0, SIZE_BUFF))>0) { bufOutput.Write(buffer, 0, bytesRead); } Chỉ có khác biệt mà bạn phải nhớ cho phải tuôn ghi (flush) nội dung buffer bạn muốn ... constructor buffere stream: BufferedStrream bufInput = new BufferedStream(inputstream); BufferedStream bufOutput =new BufferedStream(outputstream); Sau đó, bạn sử dụng BufferedStream stream bình thường, ... thích hợp file-base streaming giống lớp DirectoryInfo FileInfo, lớp FileStream cho phép mở tập tin hữu tạo file Khi tạo tập tin , lớp FileStream thường dùng enum FileMode, FileAccess FileShare...
- 8
- 335
- 0
Tài liệu Bài 8: File and Registry ppt
... ReadWrite, or Write – Để đọc ghi byte, dùng hàm: ReadByte(): đọc byte từ stream WriteByte(byte): ghi byte vào stream Read/Write(byte[], int off, int count): đọc/ghi mảng byte off, độ dài count – Sau đọc/ghi, ... Dung lượng (bytes), với FileInfo File and Registry - Editor: Đoàn Quang Editor: Đoà Minh Managing the File System // khởi tạo biến myFile trỏ đến tập tin FileInfo myFile = new FileInfo(@"C:\How ... ArrayList folders = new ArrayList(); foreach(DirectoryInfo folder in theFolder.GetDirectories()) folders.Add(folder.Name); // Lấy tên file thư mục thời ArrayList files = new ArrayList(); foreach(FileInfo...
- 15
- 440
- 1
Tài liệu File and Registry Operations part 1 pdf
... FileInfo dựa path này: protected void DisplayFileInfo(string fileFullName) { FileInfo theFile = new FileInfo(fileFullName); if (!theFile.Exists) throw new FileNotFoundException("File not found: ... DisplayFolderList(string folderFullName) { DirectoryInfo theFolder = new DirectoryInfo(folderFullName); if (!theFolder.Exists) throw new DirectoryNotFoundException("Folder not found: " + folderFullName); ... string folderPath = textBoxInput.Text; DirectoryInfo theFolder = new DirectoryInfo(folderPath); if (theFolder.Exists) { DisplayFolderList(theFolder.FullName); return; } FileInfo theFile = new FileInfo(folderPath);...
- 8
- 400
- 1
Tài liệu File and Registry Operations part 2 pdf
... DisplayFileInfo(string fileFullName) { FileInfo theFile = new FileInfo(fileFullName); if (!theFile.Exists) throw new FileNotFoundException("File not found: " + fileFullName); textBoxFileName.Text = theFile.Name; ... DirectoryNotFoundException("Folder not found: " + folderFullName); ClearAllFields(); DisableMoveFeatures(); textBoxFolder.Text = theFolder.FullName; currentFolderPath = theFolder.FullName; // list all subfolders in folder ... folder foreach(DirectoryInfo nextFolder in theFolder.GetDirectories()) listBoxFolders.Items.Add(NextFolder.Name); // list all files in folder foreach(FileInfo nextFile in theFolder.GetFiles())...
- 5
- 377
- 0
Tài liệu File and Registry Operations part 3 docx
... đêm: while ((bytesRead = bufInput.Read(buffer, 0, SIZE_BUFF))>0) { bufOutput.Write(buffer, 0, bytesRead); } Chỉ có khác biệt mà bạn phải nhớ cho phải tuôn ghi (flush) nội dung buffer bạn muốn ... constructor buffere stream: BufferedStrream bufInput = new BufferedStream(inputstream); BufferedStream bufOutput =new BufferedStream(outputstream); Sau đó, bạn sử dụng BufferedStream stream bình thường, ... thích hợp file-base streaming giống lớp DirectoryInfo FileInfo, lớp FileStream cho phép mở tập tin hữu tạo file Khi tạo tập tin , lớp FileStream thường dùng enum FileMode, FileAccess FileShare...
- 8
- 295
- 0
Tài liệu File and Registry Operations part 4 pptx
... HKLM\Software\Microsoft, bạn phải lấy qui chiếu key sau : RegistryKey hklm = Registry.LocalMachine; RegistryKey hkSoftware = hklm.OpenSubKey("Software"); RegistryKey hkMicrosoft = hkSoftware.OpenSubKey("Microsoft"); ... thay đổi key Microsoft RegistryKey hklm = Registry.LocalMachine; RegistryKey hkSoftware = hklm.OpenSubKey("Software"); RegistryKey hkMicrosoft = hkSoftware.OpenSubKey("Microsoft", true); Phương ... trữ Registry HKEY_PERFORMANCE_DATA chứa thông tin liên quan đến thành tích ứng dụng chạy Trong lòng hive cấu trúc gồm Registry key Mỗi key (mục khoá) cũnggiống folder file file system Tuy nhiên...
- 5
- 306
- 0
Tài liệu Module 3: Configuring File and Print Servers docx
... options for determining how to implement offline files in a shared folder Delivery Tip Demonstrate the procedure for configuring files for offline use To change offline file options for a shared folder, ... Configuring a Client Computer for Offline Files Offline Files must be enabled before a file or folder can be made available for use offline In computers running Windows 2000 Server, the Offline ... shared folders for offline use, encrypt files with EFS, and configure Dfs to organize shared resources Creating Shared Folders Assigning Permissions to Folders Configuring Shared Folders for Offline...
- 52
- 374
- 0
Tài liệu Bài 8: File and Registry docx
... ReadWrite, or Write – Để đọc ghi byte, dùng hàm: ReadByte(): đọc byte từ stream WriteByte(byte): ghi byte vào stream Read/Write(byte[], int off, int count): đọc/ghi mảng byte off, độ dài count – Sau đọc/ghi, ... Dung lượng (bytes), với FileInfo File and Registry - Editor: Đoàn Quang Editor: Đoà Minh Managing the File System // khởi tạo biến myFile trỏ đến tập tin FileInfo myFile = new FileInfo(@"C:\How ... ArrayList folders = new ArrayList(); foreach(DirectoryInfo folder in theFolder.GetDirectories()) folders.Add(folder.Name); // Lấy tên file thư mục thời ArrayList files = new ArrayList(); foreach(FileInfo...
- 15
- 454
- 0
Tài liệu OPL DATA FILE AND DATABASE HANDLING ppt
... REM If file doesn’t exist, ignore error CREATE “temp”,B ,f% ,f& ,f, f$ PRINT “Copying EXAMPLE to TEMP” USE A REM the EXAMPLE file DO IF a .f% >30 and a .f
- 19
- 651
- 0
Stored Procedures, Triggers, and User-Defined Functions on DB2 Universal Database for iSeries doc
... Triggers, and User-Defined Functions on DB2 Universal Database for iSeries User-defined functions and user-defined table functions UDFs and user-defined table functions (UDTFs) are user-written ... User-Defined Functions on DB2 Universal Database for iSeries Notices This information was developed for products and services offered in the U.S.A IBM may not offer the products, services, or features ... enrich the functionality of the database manager by adding new functions to the set of built-in functions UDFs are scalar functions, which means functions that receive some parameters, perform some...
- 594
- 3,044
- 0
Báo cáo khoa học: Making sense of G-quadruplex and i-motif functions in oncogene promoters pot
... 3′ 5′ 5′ 3′ OFF OFF 3′ 5′ TBP hnRNP K 5′ 3′ ON i-motif Transcriptionally active form G-quadruplexinteractive compound E NM23-H2 3′ 5′ 5′ 3′ OFF Fig Cartoon showing the involvement of NM23-H2, nucleolin ... drive the formation of a favored i-motif [16] For example, in the case of the Bcl-2 i-motif, specific interactions between bases in the loops are believed to be responsible for the stability of the ... of classifying G-quadruplexes in promoter regions, such as by folding patterns or whether the biological function is suppression or activation of gene expression; however, for the purpose of...
- 11
- 366
- 0
Báo cáo khoa học: Gene duplication and separation of functions in aB-crystallin from zebrafish (Danio rerio) pptx
... MDIAINPP-FRRILFPIFFPR RQFGEHITEADVIS -SL -YSQ MEISIQHPWYRRPLFPGFFPYRIFDQYFGEHLSDSDPFSPFYTM -FYY MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLR MDIAIQHPWFRRSFWQSFFPSRIFDQHFGEHVSESEVLAPYPSV ... ######## RSSFLRSPSWMESGVSEVKMEKDQFSLSLDVKHFAPEELSVKIIGDFIEI RPYLWRFPSWWDSGMSEMRQDRDRFVINLDVKHFSPDELTVKVNEDFIEI PPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEV RPSFFRWPSWVESGLSEMKMEKDRFTINLDVKHFTPEELGVKVSGDYIEV ... 101 98 HAKHEDRQDGHGFVSREFLRKYRVPVGVDPASITSSLSSDGVLTVTGPLK HGKHDERQDDHGIVAREFFRKYKIPAGVDPGAITSSLSSDGVLTINTLRH HGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRK HAKHEDRQDDHGFVSREFHRKYRVPSGVDPTSITSSLSSDGVLTITAPRK...
- 10
- 372
- 0
Tìm thêm: xác định các nguyên tắc biên soạn khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng 9 tr 25