relationship thus matching with laboratory tests is essential in determining the soil parameters the soil parameters of the hyperbolic cam clay model were determined by simulating a cons
Biomarker profiling of ageing and neurodegenerative disease
... [153-156] In clear contrast to total tau, the CSF P-tau is hardly a marker of neuronal damage, but rather of an AD-specific increase in tau protein phosphorylation Therefore, the main advantage of this ... modifications in the affected tissues and in cellular and animal models [73] 1.2.2.3 Risk factors of AD The dominant risk factor associated with the neurodegenerative diseases is increasing age Although the ... system [5] Brain aging has become an area of intense research, as oxidative stress in brain is emerging as a potential causal factor in aging and ageassociated neurodegenerative diseases [6-11]...
- 267
- 1,200
- 0
Báo cáo y học: "A semi-quantitative GeLC-MS analysis of temporal proteome expression in the emerging nosocomial pathogen Ochrobactrum anthrop" pptx
... MGCARQAFPWRRTIMKFYQKLLAATALVALMSGAASA 17982205 Transketolase MLCVPLPSGASSRKAA 17982141 ATP synthase F1, beta chain MAKAATPKTTAAAEA 17982826 DNA-binding protein HU alpha MPMNKNELVA 17982154* Leucine, isoleucine, valine, ... triggered by signal peptides) Additional data files The following additional data are available with the online version of this paper Additional data file is a figure illustrating the superpathway of ... nature of bacterial enzymes with a number of proteins that could also have been classified within the Metabolism of amino acids category The rapid increase in genomic data over the past decade...
- 18
- 421
- 0
Ecological Assessment of Water Quality by Three-species Acute Toxicity Test and GC/MS Analysis - A Case Study of Agricultural Drains
... the fish acute toxicity test, therefore a larval fish of Oryzias latipes was used in this study (Liu et al., 2007) The larval fish assay has an advantage in considerably reducing the volume of ... to quantify the ecotoxicity level of river water from an urban area in Japan and agricultural drains when agricultural chemicals are applied In addition, analysis of agricultural chemicals by GC/MS ... Sagami Bay Fig - Location of sampling sites (Kanagawa Prefecture, Japan) Preparation of Samples for Analysis All water samples were filtrated using a μm glass fiber filter, and then concentrated...
- 8
- 667
- 0
Tài liệu Báo cáo khoa học: Analysis of proteins and peptides on a chromatographic timescale by electron-transfer dissociation MS ppt
... ⁄ z values for the fragments within a given ion series that differ by a single amino acid affords the mass and thus the identity of the extra residue in the larger of the two fragments The complete ... and z¢Æ-type fragment ions, and then reacting them with a second anion that functions as a base rather than an electron donor The carboxylate anion of benzoic acid satisfies this requirement and ... experimental conditions, the other nine proteins were probably retained on the HPLC column It is of note that the calculated and experimental average molecular masses for 42 of the proteins disagreed The...
- 8
- 578
- 0
TECHNIQUES FOR THE ANALYSIS OF ORGANIC CHEMECALS BY INDUCTIVELY COUPLED PLASMA MASS SPECTROMETRY (ICP-MS) pptx
... solution into the spray chamber by self-aspiration The spray chamber and plasma torch are made of highpurity quartz and any seals in the sample introduction and drain systems are replaced with solvent ... Typically, a 20% oxygen in argon is used, rather than pure oxygen, avoiding the use of highly flammable or explosive gases in the laboratory The oxygen is added either in the spray chamber or using ... can disrupt or even extinguish the plasma For routine analysis of such solvents, it is essential that the vapor pressure is controlled by cooling the spray chamber, where the sample aerosol is...
- 6
- 610
- 0
An Analysis of OTC Interest Rate Derivatives Transactions: Implications for Public Reporting docx
... comparable transaction data available to a participant for evaluating swap contract pricing may be low We caveat that these findings reflect trading activity at the time of our sample The introduction ... bond rates and swap rates Dealers can offset their swaps positions by transacting with other dealers in the interdealer market or by finding a customer with interest in an opposing transaction As ... terms of all swap trades made by a dealer in the same currency on that day up to the point of the large trade Analyzing offsetting activity: We identified all IRS trades made by the dealer in the...
- 23
- 533
- 0
analysis of derivatives
... manager is hedged against an increase in stock prices until the cash is received and invested The disadvantage of such a transaction is that the manager is also hedged against any decreases in ... is the fact that they mature in a certain number of days and are based on a rate that applies to an instrument maturing in a certain number of days measured from the maturity of the FRA Thus, there ... terminates on a later date Often the derivative's payoff is determined andlor made on the expiration date, although that is not always the case In accordance with the usual rules of law, a derivative...
- 672
- 274
- 0
Báo cáo vật lý: "Analysis of Trace Elements in Teeth by ICP-MS: Implications for Caries" pptx
... from National Institute of Standard and Technology (NIST) was used as a standard for quality assurance Table shows the concentrations of trace elements in bovine liver 2.4 Statistical Analysis The ... Egypt is a rural area, and its inhabitants obtain their livelihood from agriculture In addition, the inhabitants of this city drink underground water, and 99% of the population cooks their meals ... humans and can complicate any attempts at changing dietary habits to alter the intake of trace elements Shashikiran et al.15 found that, among different ethnic groups, there is a lot of variation in...
- 12
- 429
- 0
Báo cáo y học: "Flow cytometry analysis of glucocorticoid receptor expression and binding in steroid-sensitive and steroid-resistant patients with systemic lupus erythematosus" pps
... (SPSS Inc, Chicago, IL, USA) was used for the analysis Results Evaluation of FCM analysis of GR In several tissues and cultured cells lines, administration of a GR agonist results in a significant ... of FCM analysis of GR binding by RLBA Analysis of GR binding in (a) K562 and (b) U937 with and without 10-6 M Dex by FITC-DexRLBA FCM and RLBA Parallel FCM-FITC-Dex and radiometric assays were ... of the statistical analyses and revised the manuscript XZ participated in study design, interpretation of data and revision of the manuscript WZ contributed in FCM analysis of GR WG participated...
- 11
- 414
- 0
báo cáo khoa học: " Analysis of a post-translational steroid induction system for GIGANTEA in Arabidopsis" pdf
... GI, 5'-ACTGGTGGTGGATCAAGAGG-3' and 5'-GAATTAGGGAACAGCCACGA-3' for CO, 5'-CTGGAACAACCTTTGGCA AT-3' and 5'-TACACTGTTTGCCTGCCAAG-3' for FT, 5'-CGAAAGCTTCCTCCTGGTTA-3' and 5'-GAGTTTTGCCCCTCACCATA-3' ... 5'-GATTCCACGAGTTTGGGAGA-3' and 5'-CCTTAGCCATTGGGAGATCA-3' for TOC1, 5'-GCGTTGCCTCCTAATGGTAA-3' and 5'ACCCTCCAACTCCCTGTACC-3' for HAP 3A, 5'TGCTTTTTCATCGACACTGC-3' and 5'-CCATATGTGTCCGCAAAATG-3' ... transcript abundance of the putative flowering-time gene HAP 3A in transgenic (TG) and control Arabidopsis plants Analysis of transcript abundance of the putative flowering-time gene HAP 3A in transgenic...
- 13
- 245
- 0
Báo cáo y học: " Chemical fingerprinting and quantitative analysis of a Panax notoginseng preparation using HPLC-UV and HPLC-MS" pdf
... mg/ml) The ten saponins with available standard substances were quantitatively determined and made up 68.46%-75.85% of the total saponins nominal Thus, combined with the semi-quantification data, ... such as flavonoids, lignins, anthraquinones and alkaloids Determination of the main saponins in the XST injection As shown in Figure 2A, 27 saponins were well separated, of which 25 were potentially ... of each saponin were selected and listed in Table The developed analytical method was successfully applied to analysis of ten batches of the XST injection All of the 27 characteristic peaks were...
- 8
- 471
- 0
Static and Dynamic Analysis of Space frames
... package “BaseWin” before installing any application Existing RM2000/GP20000 installation should be uninstalled and replaced by the Basic installation and the single installation of RM2000 and GP2000 ... local variables in formula and in tables: Example: Name Expression • : : XXX (a, b) 2 *a+ b Data base locking activated : Just one application can access the database at one time to avoid data loss ... (LCOMB) Please review existing data (factors for “favourable” and “unfavourable”) after installation of latest version Modified consideration of “favourable” / “unfavourable” in the load combination...
- 19
- 633
- 0
Static and Dynamic Analysis of Spaceframes
... Insert the loading cases applicable to the Constraint criteria (Bottom Table) Loading case as FIXED – LCFIX with the factor as 1.0 Loading Case as VARIABLE – LCVAR with the factor as ‘VAR’ Insert the ... Elements Insert the loading cases applicable to the Constraint criteria (Bottom Table) Loading case as FIXED – LCFIX with the factor as 1.0 Loading Cases - as VARIABLE – LCVAR with the factor as ‘VAR’ ... describe it as T-MAX Create Load case Specify the additional Input in RM2000 Define a Loading case containing the T-MAX load set Stage - Action Temp-Var Insert a calculation action “TempVar”: Inp1:...
- 34
- 1,125
- 1
Static and Dynamic Analysis of Spaceframes
... stored with the attached parameters in the material list of the database The material list may be generated by importing data from existing material data files or directly in the GUI in the function ... user The only way to change this data is to delete the generated data in the database and then to re-generate it A typical example of the application of macros is the generation of the Finite ... Functionality User Guide 1-6 The initial Standard Database setup function can not be used for changing, deleting or adding data in the Standard Database If the data in the Standard Database must...
- 484
- 1,189
- 1
Báo cáo y học: "Medical resource utilization among patients with ventilator-associated pneumonia: pooled analysis of randomized studies of doripenem versus comparators"
... design, analysis of results, interpretation of findings, and drafting of the paper Independent statistical analysis The accuracy of the data analysis was independently verified by William Shannon, ... baseline microbiology of P aeruginosa or MRSA was included as a clinically important variable Assumption of proportional hazards was tested in each case by examining the effect -by- time interaction ... effect jointly for all covariates, and individually for each covariate entered into the model The proportional hazards assumption was validated for each model Statistical Analysis Software version...
- 10
- 557
- 1
Báo cáo y học: "Segment-orientated analysis of two-dimensional strain and strain rate as assessed by velocity vector imaging in patients with acute myocardial infarction"
... expressed as mean ± standard deviation after ascertaining a normal distribution We performed the unpaired or paired t -tests and one-way repeated measures analysis of variance (ANOVA) If the ANOVA test ... PCI, were enrolled in this study Successful acute revascularization of the infarcted area was achieved by recanalisation, PCI and Stenting of the culprit lesion in the infarct-related artery (LAD) ... of all Strain Rate Imaging algorithms is the huge variability of comparable parameters and values, which are provided by different ultrasound machines and software algorithms There are neither...
- 8
- 683
- 0
Báo cáo y học: " Laugh Yourself into a Healthier Person: A Cross Cultural Analysis of the Effects of Varying Levels of Laughter on Health"
... opercular areas and travels via the motor cortex and pyramidal tract to the ventral brain stem The involuntary path is comprised of amygdala, thalamic, hypothalamic, and subthalamic areas, in addition ... the particular view of the individual that makes them an individualist, but it is the differing views of a group of individuals that makes an individualist society Conversely, Aurangabad is homogenous ... distinct samples were surveyed The first sample was from Mississauga (MISS), Canada representing an individualistic society, and the second sample from Aurangabad (AUR), India representing a collectivist...
- 12
- 757
- 0
An analysis of key changes under ucp 600 compared to ucp 500 and recommendations for better ucp 600 application.doc
... by dating and signing across its face, thereby incurring a legal obligation to pay the amount of the draft at maturity Paying bank The bank authorized in the letter of credit by the issuing bank ... discharge, and/or the final destination (as appropriate) stated in the credit Date of issuance is deemed the date of dispatch, taking in charge or shipment, unless otherwise indicated The name ... Advising/Confirming Bank That bank check the documents against the letter of credit and forwards them to the Issuing Bank The drawing is negotiated, paid or accepted as the case may be Step The Issuing Bank...
- 89
- 965
- 2
current situation of outsourcing development, a number of favorable factors promoting this industry as well as analysis of outsourcing activities FPT Software.doc
... approximately the same as India’s a decade ago and the wage rates in Vietnam are roughly the same as India’s initial rates As such, a lot of people have raised the question that whether Vietnam can ... headquarters in Tokyo and a representative office in Osaka, Japan Following the success of FPT Software Japan, FPT Software APAC was established in January 2007, with its head office in Singapore ... types, advantages and disadvantages, then the software outsourcing development in the world, in India and China Chapter two investigates the development of software outsourcing in Vietnam and focuses...
- 79
- 611
- 6
Báo cáo y học: "Proteomic analysis of mechanisms of hypoxia-induced apoptosis in trophoblastic cells"
... medium was then aspirated and replaced with DMSO The absorbance was read at 540nm in a microtiter plate reader Quantitation of internucleosomal DNA fragmentation by ELISA Internucleosomal DNA fragmentation ... PTEN, and caspase-3 mRNA quantities were analyzed in triplicate, normalized against GAPDH as a control gene and expressed in relation to a calibrator sample Statistical analysis Experiments for the ... Pharmingen, San Diego, CA, USA) system We selected 40 apoptosis-related proteins to examine the mechanism of hypoxia-induced apoptosis After the JAR cells were exposed to hypoxia or maintained...
- 9
- 499
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế điều tra đối với đối tượng giảng viên và đối tượng quản lí điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ