... fluorescence intensity was much stronger at a later time Figure shows that the fluorescence intensity increased almost linearly during the incubation period from 30 to 55 min, demonstrating a gradual increase ... obtained from the Cell Bank of Shanghai Science Academy were seeded onto a glass cover slip placed in a culture dish containing DMEM-H medium with 10% fetal bovine serum, 100 lg mL-1 streptomycin ... color at an early time (30 min), indicating there were no QDs in these lysosomes; while at a later time (55 min), most lysosomes showed a yellow color (a color representing the mixed fluorescence...
... are growing when the magnetic field intensity is increased This is conditioned by growth of the magnetic quantization contribution into the CC energy increase Inter level distance is increased ... applications, in particular in large twodimensional focal plane arrays in the mid- and far infrared (M&FIR) region, having important applications in the fields of pollution detection, thermal imaging object ... interaction energy Thus, the problem is reduced to analytical determination of the energy separate expressions for electron and hole (as for non-interacting particles) The quantum dot shape indicates...
... probably modifications to the quantum confinement of electrons and holes in the CdSe QD are interactions between surface atoms and lipids and proteins (mostly interacting with Cd atoms) as well ... The other important finding is that the relaxation energy in the QDs inside cells is relatively small and independent of the excitation power, while it increases quickly in the QDs outside of ... photoluminescence blue shift of the quantumdotsin living cells: effect of oxidation by singlet oxygen J Am Chem Soc 2006, 128:13396-13401 Fu Y, Han TT, Luo Y, Ågren H: Multiphoton excitation of quantum...
... sativa line M699, seeds being kindly provided by Diego Rubiales (IAS-CSIC, Spain) Well-developed petioles from 25 day old in vitro germinated M699 seedlings were used as explants for callus induction ... cell viability, mainly in cases where cells were isolated They also showed that some cells in aggregates maintain a certain degree of viability Quantum dot uptake M sativa cells internalized mercaptopropanoic ... diacetate; DAB: 3,3’diaminobenzidine; NBT: Nitroblue tetrazolium; H2DCFDA: 2’,7’dichlorodihydrofluorescein diacetate Competing interests The authors declare that they have no competing interests Authors’...
... enough to minimize the strain The obtained structures were doped in two different ways: with intra-dot doping (devices B44 and B52) and with inter-dot doping (devices B45 and B53) Indevices B44 ... 6:21 Sablon KA, Mitin V, Sergeev A, Little JW, Vagidov N, Reinhardt K, Olver KA: Nanoscale engineering: optimizing electron-hole kinetics of quantum dot solar cells In Proceedings of SPIE: April ... barriers around single dotsin directions perpendicular and parallel to QD planes model adequately takes into account the main effects of doping on photoelectron kinetics Bipolar kinetics: solar...
... cultured in the cell culture medium containing μg/ mL adriamycin (Sigma) Both cell lines were maintained in RPMI-1640 medium containing 10% FCS, 100 U/ml of penicillin, and 100 μg/ml of streptomycin ... from the Institute of Hematology of Tianjin, Chinese Academy of Medical Sciences (Tianjin, China) To develop the drugresistant cell line (HepG2/ADM), adriamycin was added to HepG2 cells in a stepwise ... fixed in 100% methanol for 10 Cell monolayers were blocked in 5% BSA in PBS for 45 and incubated for h at room temperature with P-gp antibodies (Invitrogen, Beijing, China), followed by incubation...
... self-assembled quantumdots Phys Rev B 2000, 62:13595 Vdovin EE, Levin A, Patanè A, Eaves L, Main PC, Khanin YN, Dubrovskii YV, Henini M, Hill G: Imaging the electron wave function in self-assembled quantum ... Bennett CH, DiVincenzo P: Quantum information and computation Nature 2000, 404:247 Patane A, Levin A, Polimeni A, Eaves L, Main PC, Henini M, Hill G: Carrier thermalization within a disordered ... emission are in anti-phase with each other The observed reduction of contact emission and increase of QD emission in low bias can be explained by the reduction of holes recombining in GaAs contact...
... optical gain enhancement [20] and photoluminescence enhancement [21], optical switching [22, 23], quantum information processing [24, 25] and electromagnetically induced transparency [26] QI in a ... the QDs doped in 3D–PCs have been widely studied, both experimentally and theoretically [15–19] Controlling spontaneous emission by using quantum optics would lead to several interesting effects, ... J.N Winn, R.D Meade, Photonic Crystals: Molding the Flow of Light (Princeton University Press, Princeton, 1995) C.M Soukoulis, Photonic Crystals and Light Localization in the 21st Century (Springer,...
... to describe inter-atomic forces by using bond stretching and bending The role of strain (for three different shapes) in determining the bound levels is analyzed in detail Considering three different ... was grown on semi-insulating GaAs (001) substrates by using the solid-source molecular beam epitaxy (MBE) Five layers of nominally 3.0 momolayer (ML) InAs (quantum dots) were inserted between ... the quantum dot density in the lower layer is higher than that in the upper layer The near-infrared photoluminescence (PL) as a function of energy at 77 K is shown in Fig A main peak corresponding...
... translate QDs for use in clinical applications such as in vivo imaging in human subjects Modeling studies have revealed that two spectral windows exist for QD imaging in living subjects, one at ... exhibited high affinity integrin avb3 specific binding in cell culture and ex vivo In vivo NIR fluorescence (NIRF) imaging was carried out on athymic nude mice bearing subcutaneous integrin avb3-positive ... in vivo targeted imaging using QDs, as extravasation is not required to observe tumor signal Arginine–glycine–aspartic acid (RGD; potent integrin avb3 antagonist) containing peptides were conjugated...
... technique is used in the present work for probing the electronic transitions in CdS quantumdots and correlating the observed data with the theoretical transitions obtained from a noninteracting particle ... limiting behavior The nonlinearity is probed using the z-scan technique Optical limiting can be due to a variety of nonlinear optical processes such as self focusing, self defocusing, nonlinear ... analysis, used in the present work and proposed for the first time by Nandakumar et al [13], is that it eliminates the use of bulk parameters in the calculation Including Coloumb interaction into the...
... illustrate less strain relaxation for high index surfaces [19] The inhibition of strain relaxation inside the islands, by increasing the island internal energy term, should determine a delay in the 3D ... resulting edges of the QD During the SK growth of InAs 123 QDs, the main driving force forming islands is the strain relaxation, which permits relief of part of the strain induced by the lattice mismatch ... demonstrates the *12 meV exciton binding energy in these dots Due to the fact that the excitons in the WL easily interacted with the phonon and quenched, the integrated PL intensity of the 123 612 Nanoscale...
... 1), allowing a higher Q factor to be achieved in this spectral region Gaining a better insight into these experimental findings, we have studied spectra of CdTe/PS microspheres using low intensity ... certainly highly efficient having an intensity comparable to the Stokes PL as seen from Fig We found that the integrated intensity of ASPL has an almost linear dependence on the excitation intensity ... be distinguished in the spectral region between them To gain more insight into the WGM structure in the microcavity we carried out a fast Fourier analysis, which makes it possible to investigate...
... Single Molecules in Self-Organized InP/GaInP QuantumDots Alexander M Mintairov, James L Merz and Steven A Blundell Chapter InAs QuantumDotsin Symmetric InGaAs/GaAs Quantum Wells 153 Tetyana V Torchynska ... potential confinement by using higher indium composition in the dots a spectral width of 230nm was predicted in the In0 .9Ga0.1As/GaAs quantum dot system (Sun & Ding, 1999) In general, such inhomogeneous ... corresponding maximum continuous-wave output power was 0.65mW Spectral broadening using height engineered InAs/GaAs quantumdots Tuning the emission properties of QDs assemblies by in- situ annealing...
... digoxigenin-11-dUTP or biotin-16-dUTP FISH was carried out according to [20] For combined probing of rDNA and non-coding satellite DNA, in situ hybridisation was performed using 20 ng of digoxigenin-labeled ... enlarged quantumdots are shown in square inset Michalet X, Pinaud FF, Bentolila LA, Tsay JM, Doose S, Li JJ, Sundaresan G, Wu AM, Gambhir SS, Weiss S: Quantumdots for live cells, in vivo imaging, ... previously demonstrated in similar applications [2] To improve the performance of quantumdotsinin situ hybridisation the following strategies were tested: (1) instead of fixation in an ethanol : acetic...
... streptavidincoated QDs (4-10 streptavidin molecules (53 kD each)/ QD giving 16-40 biotin binding sites implying 16-40 conjugated PH-GFP protein molecules per QD) resulting in a significant increase in ... Akt-PH-EGFP via intein mediated protein splicing In vivo conjugation of QD's to Akt-PH-EGFP via intein mediated protein splicing (a) Schematic representation of site-specific intein-mediated conjugation ... using 2% cysteine-HCl, pH 7.8, then maintained in 0.1 × Marcc's Modified Ringer's (0.1 × MMR) Microinjections were performed in 4% Ficoll in 0.33 × MMR The embryos were injected with RNA and Intein...
... peptide (DnaE IC-Biotin) and biotinylated N-terminus DnaB mini-intein peptide (Biotin-DnaB IN) The 47 amino acid peptide sequence of the C-terminus DnaE intein peptide (DnaE IC-Biotin): MVKVIGRRSLGVQRIFDIGLPQDHNFLLANGAIAANCFDYKDDDDK(Ahx-Biotin)G ... conferring genetic mobility to Page of 14 the intein [35] During intein evolution however, some inteins lost sequence continuity, such as the DnaE split intein, and as a result they exist in two ... residue at the C-terminus of the intein to form succinimide [26], leading to excision of the intein and ligation of the exteins Inteins have been widely used for in vitro protein semi-synthesis...
... characterization DB participated in conceiving the biological testing and interpreting the data YKG conceived the study, participated in its design and coordination and helped in writing the manuscript All ... Pharmaceutical Science, Trinity College Dublin Author details School of Chemistry, Trinity College Dublin, Dublin 2, Ireland 2School of Pharmacy and Pharmacology, Trinity College Dublin, Dublin 2, Ireland ... ImageJ software An Olympus FV1000 Point-Scanning Confocal Microscope was used to examine the cells after staining with QDs and counter-staining with DAPI or Calcein AM Sequential acquisition was...
... He interpreted his experimental results as direct DonorAcceptor recombination involving CuZn and Cu-X centers combined with indirect recombination via excited states of these centers Doping introduced ... Chapter Introduction experimental results In the same year, Godlewski investigated the recombination processes in Cu-doped ZnSe single crystal by monitoring the Cu-green, Cu-red and infrared ... (1.9) The integration can be separated into the integration of the fast oscillating Bloch part and the integration of the envelope part The integration of the Bloch part results in the sizeindependent...
... 38 2.3 TPA in strong confinement quantumdots 39 2.3.1 General information of TPA transition inquantumdots 40 2.3.2 TPA transition inquantumdots considering band mixing 41 2.3.2.1 Interband ... QUANTUMDOTS 70 4.1 Introduction 70 4.2 Synthesis and characterization of CdSe quantumdots 74 4.3 TPA coefficients in CdSe quantumdots 79 4.4 Auger process following TPA in CdSe quantumdots 83 ... Luttinger and Kohn model is a starting point to obtain the hole eigen-states and the energies inquantumdots It takes into account the spin-orbit interaction as well as the six valence bands In...