prbp pdedelta has a wide tissue distribution
Báo cáo khoa học: A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents pdf
... QLQRDALRHFAPCPPRARGLQEARVALEPALEPGFAARLQAQRICLERADAGPLGVAGS RAT R3E 119 QLQRDALRHFAPCPPRTRGLQDARIALEPALEPGFAARLQAQRICLERADAGPLGVAGS HUMAN R3E 119 QLQRDALRHFAPCQPRARGLQEARAALEPASEPGFAARLLTQRICLERAEAGPLGVAGS PP1 ... ARVLDLAYEKRVSVRWSADGWRSLRESPASYAGPAPSPPRADRFAFRLPAPPVGGTLLF RAT R3E 178 ARVLDLAYEKRVSVRWSADGWRSLRESPASYAGPAPAPPRADRFAFRLPAPPVGGALLF HUMAN R3E 178 ARVVDLAYEKRVSVRWSADGWRSQREAPAAYAGPAPPPPRADRFAFRLPAPPIGGALLF GM/ RGL/R 3A ... gacgaggcgcctgcggccgacggcggaaaacaccaaaggcacccgggggcggggcgacccgatgtggcggggaggagtag 920 I H F I * 279 921 gagagaccaggattggcgggagcggtccaagggagtc 957 Fig (A) Diagram of human PPP1R3E mRNA compared with PPP1R3E...
- 12
- 381
- 0
báo cáo khoa học: " The YlmG protein has a conserved function related to the distribution of nucleoids in chloroplasts and cyanobacteria" pdf
... 5'-GACAGGTTCAGGTCATAGAAG-3' for At5g21920, 5'-TATCTGAACACTCCGTTGACGGTA-3' and 5'-CAAAGATA AACGGAATACGATC-3' for At4g27990, 5'-GCAATGGGAAGCAGTGGTGG-3' and 5'-GGGAGAAGAGACGGGTTTCG-3' for GAPDH, and ... (Takara) with oligo(dT)15 primer PCR was performed by using primers 5'-CACCGAGAAGTCAACAGCTCGGTCATCGAC-3' and 5'-TCAAGTCTTCCAATTTCTACCCAGTGCTGC-3' for AtYLMG1-1, 5'CCTCAACATATATAACACCATC-3' and ... inserted 35S-cDNA in the FOX lines, the insertion was amplified by PCR using primers 5'GTACGTATTTTTACAACAATTACCAACAAC-3' and 5'-GGATTCAATCTTAAGAAACTTTATTGCCAA-3', and then sequenced by a primer 5'-CCCCCCCCCCCCD...
- 13
- 453
- 0
Báo cáo sinh học: "Tissue distribution of a plasmid DNA encoding Hsp65 gene is dependent on the dose administered through intramuscular delivery" docx
... pairs 5'- ACC AAC GAT GGC GTG TCC AT-3' and 5'- TAG AAG GCA CAG TCG AGG-3', resulting in a 400bp cDNA encoding Hsp65, or the primer pairs 5'- GTG GGC CGC TCT AGG CAC CAA-3'and 5'- CTC TTT GAT ... suggests that some extrachromosomal plasmid DNA was maintained for at least months Southern blot analysis was done with liver and muscle (data not shown) samples at 30 days after immunization due ... cloning: a laboratory manual 2nd edition Cold Spring Harbor Laboratory Press; 1989 Mearini G, Nielsen PE, Fackelmayer FO: Localization and dynamics of small circular DNA in live mammalian nuclei...
- 10
- 243
- 0
Tài liệu Báo cáo khoa học: Neuropeptide Y-family receptors Y6and Y7in chicken Cloning, pharmacological characterization, tissue distribution and conserved synteny with human chromosome region docx
... CaCl2, aliquoted and stored at )80 °C used: forward primer 5¢- CAATTGGGAAGAAAACCAG ACA and reverse primer 5¢- GCACAATGTATTCACCAG CAGA Actin, used as a positive control to monitor the efficacy of ... polymerase (Stratagene, La Jolla, USA) The 5¢ primer contained a HindIII restriction site (underlined) and had the sequence 5¢-gacatcaaagcttATGGATAAAGCCATT CAGCATCCT-3¢, and the 3¢ primer had a XhoI ... placental mammals Perhaps the gene was easily disposable because the mammalian ancestor had equally narrow tissue distribution as the chicken today In conclusion, we cloned and studied the tissue...
- 16
- 580
- 0
Báo cáo khoa học: Deficiency in apolipoprotein E has a protective effect on diet-induced nonalcoholic fatty liver disease in mice pot
... containing a targeted replacement of the mouse apoE gene for the human apoE3 gene), we have shown that, in addition to its role in the maintenance of plasma lipid homeostasis, apoE plays a central ... had a much lower steady-state plasma FFA concentration of 1.4 ± 0.1 mmol eq.; P < 0.005) Despite this apparent increase in lipoprotein lipase-mediated FFA production and in steady-state plasma ... day, animals were gavaged with 0.3 mL of olive oil and placed back in their cages for h (in our experimental set-up, dietary triglyceride absorption, measured as a post-gavage increase in plasma...
- 11
- 544
- 0
Applications of Calorimetry in a Wide Context - Differential Scanning Calorimetry, Isothermal Titration Calorimetry and Microcalorimetry docx
... Ruiz-Sanz, Diana Romanini, Mauricio Javier Braia, Mar a Cecilia Porfiri, Ruel E McKnight, Stefka G Taneva, Sonia Bañuelos, Mar a A Urbaneja, Amal A Elkordy, Robert T Forbes, Brian W Barry, Laura ... Gries, Eliane Lopes Rosado, Vanessa Chaia Kaippert, Roberta Santiago de Brito, R F B Gonçalves, J A F F Rocco, K Iha, Kazu-masa Yamada, Daniel Plano, Juan Antonio Palop, Carmen Sanmartín, Jindřich ... Liquid-Solid Phase Equilibria of Paraffinic Systems by DSC Measurements 253 Luis Alberto Alcazar-Vara and Eduardo Buenrostro-Gonzalez Chapter 12 Thermal Analysis of Phase Transitions and Crystallization...
- 484
- 3,011
- 0
Báo cáo khoa học: "Creating a CCGbank and a wide-coverage CCG lexicon for German" pdf
... Srinivas Bangalore, and K Vijay-Shanker 2005 Automated extraction of Tree-Adjoining Grammars from treebanks Natural Language Engineering Owen Rambow 1994 Formal and Computational Aspects of Natural ... International Conference on Language Resources and Evaluation (LREC), pages 19741981, Las Palmas, Spain, May Julia Hockenmaier and Mark Steedman 2002b Generative models for statistical parsing ... ODonovan, Christian Rohrer, Josef van Genabith, and Andy Way 2005 Treebank-based acquisition of multilingual unication-grammar resources Journal of Research on Language and Computation Yusuke Miyao,...
- 8
- 305
- 0
Episode 3 Hector has a date pot
... million-aire? HECTOR Psst, psst! Am I a millionaire? NICK [Laughs] Are you a millionaire? Are you a millionaire? [Laughs] Ha! We are millionaires! BRIDGET and ANNIE Good – good BRIDGET Well you can ... to wear? HECTOR But Nick, what about Bridget and Annie? NICK Aha! It’s not a problem! HECTOR [Laughs] Ah-ha-ha! Yes! ANNIE [sending email] ‘Nadia, it’s terrible news Hector killed my plant with ... Episode Hector Has a Date 11 HECTOR So, Nick, what should I say? NICK It’s easy, relax HECTOR Yeah, but you have had a hundred girlfriends NICK Yeah, well, when I said a hundred, it’s actually fewer...
- 16
- 331
- 1
Báo cáo khoa học: The HS:19 serostrain of Campylobacter jejuni has a hyaluronic acid-type capsular polysaccharide with a nonstoichiometric sorbose branch and O-methyl phosphoramidate group docx
... acid capsule is a virulence factor for mucoid group A streptococci Proc Natl Acad Sci USA 88, 8317–8321 49 Kawabata S, Kuwata H, Nakagawa I, Morimatsu S, Sano K & Hamada S (1999) Capsular hyaluronic ... deionized water (pH 9.0) containing 5% methanol as separation buffer A voltage of 20 kV was typically applied during CE separation, and +5 kV was used as electrospray voltage Mass spectra were acquired ... the HS:19 serostrain and have shown that these labile groups are an a- l-sorbofuranose branch attached at C2 of b-d-GlcA and a MeOPN modification located at C4 of b-d-GlcNAc There are very few reports...
- 15
- 430
- 0
Báo cáo khoa học: "Enhancing Unlexicalized Parsing Performance using a Wide Coverage Lexicon, Fuzzy Tag-set Mapping, and EM-HMM-based Lexical Probabilities" ppt
... from small annotated corpora, such as the Hebrew treebank (Sima’an et al., 2001) Hebrew has a wide coverage lexicon / morphological-analyzer (henceforth, KC Analyzer) available2 , but its tagset ... is applicable in any setting in which there exist a small treebank and a wide- coverage lexical resource For example parsing Arabic using the Arabic Treebank and the Buckwalter analyzer, or parsing ... over the training data, rare stands for any rare event, and wrare is a specific rare event KCA(·) is the KC Analyzer function, mapping a lexical event to a set of possible tags (analyses) according...
- 9
- 330
- 0
Báo cáo khoa học: Saccharomyces cerevisiae a1,6-mannosyltransferase has a catalytic potential to transfer a second mannose molecule ppt
... CTATGCTTTTGAA-3¢) and D18 8A- RV (5¢-TTCAAAAGC ATAGTATCCATAGCTGAGTAAATACCACCTCTTG-3¢), and the pPICZaA-ScOCH1 as a template The both D18 8A mutant and wild-type proteins were expressed as mentioned above After ... the contaminants may have a catalytic activity only toward the substrate (Man10GlcNAc2PA), where the first mannose was added to Man9GlcNAc2-PA, we purified Man10GlcNAc2-PA and used it as an acceptor, ... transmembrane region was amplified by PCR with two primers, OCH1-FW (5¢-CTCGAGAAAAGACACTTGTC AAACAAAAGGCTGCTT-3¢; the XhoI site is underlined) and OCH1-RV (5¢-TCTAGACGTTTATGACCTGCATTT Novel activity...
- 12
- 251
- 0
Mariposa: a wide-area distributed database system doc
... sites around the state of California with a wide variety of hardware and storage capacities Each site has its own database administrator, and the willingness of any site to perform work on behalf ... in a relational database management system In: Proc 1979 ACM-SIGMOD Conf on Management of Data, Boston, Mass, June Sidell J, Aoki PM, Barr S, Sah A, Staelin C, Stonebraker M, Yu A (1995) Data ... Experimental environment cache The benefit is that the calculation can be made without probing the actual metadata to see if it has changed The quality of service is then a measurement of the metadata’s...
- 16
- 379
- 0
Báo cáo khoa học: Genomic organization, tissue distribution and deletion mutation of human pyridoxine 5¢-phosphate oxidase pptx
... 5¢-TAAGGATCCCCCATGACGTGC-3¢ 5¢-CAGGATCCAGAGTTAAGGTGCAAG-3¢ 5¢-CCGAATTCGACCCAGTGAAACAGTTT-3¢ 5¢-GGAAGCTTAGTTAAGGTGCAAGTCTCTC-3¢ 5¢-CGGATCCGAGGAGGCTGTTCAGTGT 5¢-AGGATCCCTAGGGTAGGCCCCGCCG-3¢ BamHI ... by restriction and sequence analysis to ensure that the reading frame was maintained In silico analysis Materials TM A Marathon-Ready cDNA library from human brain, a multiple tissue Northern ... Consensus CGAGAG/gtgccg CACCAG/gtgggc (1492) (1185) tcctag/GCATTT tcctag/AGATGG GAGCTG/gtgggt CGTCAG/gtgagt (843) (248) ttctag/GACTCT gagcag/GTGCGT CGGGAG/gtgagt ATCCTG/gtgagt (333) (220) ggacag/TATCTG...
- 10
- 442
- 0
Báo cáo khoa học: "It Makes Sense: A Wide-Coverage Word Sense Disambiguation System for Free Text" docx
... Artificial Intelligence (AAAI), pages 1037–1042, Pittsburgh, Pennsylvania, USA Yee Seng Chan, Hwee Tou Ng, and David Chiang 200 7a Word sense disambiguation improves statistical machine translation ... Linguistics (ACL), pages 40–47, Santa Cruz, California, USA Rong-En Fan, Kai-Wei Chang, Cho-Jui Hsieh, XiangRui Wang, and Chih-Jen Lin 2008 LIBLINEAR: A library for large linear classification Journal of ... on Empirical Methods in Natural Language Processing (EMNLP), pages 41–48, Philadelphia, Pennsylvania, USA Martha Palmer, Christiane Fellbaum, Scott Cotton, Lauren Delfs, and Hoa Trang Dang 2001...
- 6
- 355
- 0
Báo cáo Y học: Human bile salt-stimulated lipase has a high frequency of size variation due to a hypervariable region in exon 11 pot
... variants with a molecular mass different to the most common variant An onco-fetal variant of BSSL, denoted feto-acinar pancreatic protein (FAPP), has been detected in human embryonic and fetal ... DNA was digested with appropriate restriction enzyme(s) Digested DNA was separated on an agarose gel, transferred to a Hybond-N ®lter (Amersham) and hybridized to a [32P]dATP-labelled probe as ... et al [32] Approximately 20 lg of each RNA preparation was separated on 1% agarose gels, blotted onto Hybond-N ®lters (Amersham International plc., Buckinghamshire, UK) and hybridized to a [32P]dATP-labelled...
- 9
- 520
- 0
The girl who looks like Taylor has a fair complexion potx
... bỏ Thông thường ta dùng đại từ “who” thay cho danh từ đại từ người “he/ she/ they….” - Ta dùng “that” thay cho “who” trường hợp Ví dụ: The girl that looks like Taylor has a fair complexion - ... động từ chia “looks” Cấu trúc “look like” = “to be like” – giống như, - “The girl … .has a fair complexion” – cô gái ….có (một) da trắng a fair complexion” = a fair skin” – da đẹp, da trắng Cụm ... looks like Taylor has a fair complexion 2 Các bạn di chuột vào cụm từ để biết chức cụm câu: The girl who looks like Taylor has a fair complexion 3 Tại câu lại dịch vậy? - Mệnh đề quan hệ xác...
- 6
- 425
- 0
USAID Supported a Wide Range of Child and Maternal Health Activities, but Lacked Detailed Spending Data and a Proven Method for Sharing Best Practices pptx
... Survival and Maternal Health account in fiscal years 2004 and 2005 helped fund wide- ranging efforts to lower maternal and child mortality in Africa, Asia and the Near East, and Latin America and ... Health Care Worker Training Source: GAO Carter Center medical library at Awassa University, Awassa, Ethiopia USAID Is Working to Increase Attention to Maternal and Newborn Health USAID has taken ... countries in Africa, Asia and the Near East, and Latin America and the Caribbean and to the Bureau for Global Health In allocating the funds, the agency considered various factors in its annual budgeting...
- 64
- 379
- 0
Báo cáo khoa học: The Thermoplasma acidophilum Lon protease has a Ser-Lys dyad active site pot
... GCGGCCAGCGTATCAATAGCC-3¢ (sense), 5¢-GGCT ATTGATACGCTGGCCGCGTCTCCTTCAACTCCCT CG-3¢ (antisense); K56 8A, 5¢-CCGGTTGGCGGCGTAAC CGCAGCGGTTGAGGCAGCTATAGAAGC-3¢ (sense), 5¢-GCTTCTATAGCTGCCTCAACCGCTGCGGTTAC ... protein as well as fused to a AAA+ ATPase-domain (Fig 1C) [6] Whereas the bacterial Lon protease and its homologues in eukaryal organelles are soluble, the archaeal counterpart is membrane-attached ... significant sequence similarity to Lon proteases [21] (Fig 1A, B) TaLon encompasses an N-terminal ATPase associated with various cellular activities (AAA+ domain) and a C-terminal protease domain,...
- 5
- 298
- 0
Báo cáo khoa học: The HS:1 serostrain of Campylobacter jejuni has a complex teichoic acid-like capsular polysaccharide with nonstoichiometric fructofuranose branches and O-methyl phosphoramidate groups pot
... H4 labeled A2 a, A2 b, A3 a, A3 b, A4 a and A4 b, respectively (Fig 4A) The 1D-NOESY of Gal H- 4a showed NOEs for Gal H- 2a, Gal H- 3a, Gal H-5 and Gal H-6 ⁄ 6¢, as well as for Fru H-4 and Fru H-6 ⁄ 6¢ ... respectively The 31 P chemical shift for the MeOPN groups was 14.67 p.p.m., and a scalar coupling 3JP,H of 11.1 Hz was observed CPS-2 Atom Type dH dC A1 A2 a A2 b A3 a A3 b A4 a A4 b A5 A6 ⁄ A6 ¢ B1 ⁄ B1¢ B2 B3 ... MeOH as mobile phase A voltage of 20 kV was 4419 Campylobacter jejuni HS:1 serostrain CPS typically applied during CE separation and )5 kV was used as electrospray voltage Mass spectra were acquired...
- 16
- 466
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các nguyên tắc biên soạn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc hệ số công suất cosp fi p2 đặc tuyến mômen quay m fi p2 động cơ điện không đồng bộ một pha thông tin liên lạc và các dịch vụ từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25