0

performance comparison of geocast routing protocols for a manet

Báo cáo hóa học:

Báo cáo hóa học: "Research Article Comparison of Channel Estimation Protocols for Coherent AF Relaying Networks in the Presence of Additive Noise and LO Phase Noise Stefan Berger and Armin Wittneben" pptx

Hóa học - Dầu khí

... baseband-to-baseband channels from A toBandfromBtoAarehAB= hej(ϕ A −ϕB),hBA= hej(ϕB−ϕ A )=hABe2j(ϕB−ϕ A ).(4)They are reciprocal, that is,hAB=hBAif A and ... T. Cui, F. Gao, and A. Nallanathan, “Optimal trainingdesign for channel estimation in amplify and forward relaynetworks,” in Proceedings of the 50th Annual IEEE GlobalTelecommunications Conference ... orthogonal channelsback to the relays. This results in a total of 2NRorthogonalchannel uses if none of the relay nodes acts as a masternode (If a relay acts as master, the number of orthogonalchannelusesreducesto2(NR−...
  • 12
  • 339
  • 0
a comparison of neural network architectures for

a comparison of neural network architectures for

Tin học

... is based on Shannon’s entropy. It is a statistical measurement of the capability of a feature to separate digit classes. If the information measure of a feature is high, it indicates that the ... for the use of neural network learning techniques for this type of application and data set, and insight about the appropriate design, use, and parameterization of the network to achieve acceptable ... between a feature’s template and the input image. A value of 0 indicates that a feature template did not match the digit image; a value of 1 indicates a complete match; and values in between these...
  • 5
  • 442
  • 0
Báo cáo hóa học:

Báo cáo hóa học: " Comparison of four different methods for reliability evaluation of ecotoxicity data: a case study of non-standard test data used in environmental risk assessments of pharmaceutical substances" pdf

Hóa học - Dầu khí

... Protection Agency), ASTM(American Society for Testing and Materials), AFNOR(Association Franỗaise de Normalisation), and ISO(International Organization for Standardization). The teststandard establishes ... pre-defined evaluation criteria . A major advantage of using a structured way of evaluatingdata is increased transparency and predictability of therisk assessment process. For instance, both a ch ecklistand ... 42(15):5807-5813.6. Molander L, Ågerstrand M, Rudén C: WikiPharma a freely available, easilyaccessible, interactive and comprehensive database for environmentaleffect data for pharmaceuticals. Regulatory Toxicology...
  • 15
  • 1,010
  • 0
Comparison of current control techniques for active filter application

Comparison of current control techniques for active filter application

Tài liệu khác

... the Department of Electronics and Informatics, University of Padova, 35131 Padova, Italy.L. Malesani and P. Mattavelli are with the Department of ElectricalEngineering, University of Padova, 35131 ... with analog PWM, althoughvery simply implementable by means of analog circuitry,provides a rather unsatisfactory performance level as faras active filter applications are concerned. This is mainlydue ... kind of application, toperform the– transformation, there is no need to knowthe instantaneous phase angle of the sinusoidal waveforms.The main advantage of such a solution is that the funda-mental...
  • 8
  • 459
  • 0
Performance Modeling of Critical Event Management for Ubiquitous Computing Applications pptx

Performance Modeling of Critical Event Management for Ubiquitous Computing Applications pptx

Tổ chức sự kiện

... a systemprovides services for routine events. For example - a smart hospi-tal, responding to the arrival of critical patients may automaticallyallocate appropriate resources such as available ... current state, and2. the average probabilities of success for reaching the normalstate from each of the neighbor state.These average probabilities of success of reaching the normal statefrom any ... reaching if no additional criticalityoccurs at state , and is the av-erage probability of reaching if an additional criticality occurs atstate . If the is not met for any state transition pathin...
  • 8
  • 534
  • 0
Báo cáo Y học: Modeling the three-dimensional structure of H+-ATPase of Neurospora crassa Proposal for a proton pathway from the analysis of internal cavities pptx

Báo cáo Y học: Modeling the three-dimensional structure of H+-ATPase of Neurospora crassa Proposal for a proton pathway from the analysis of internal cavities pptx

Báo cáo khoa học

... H+-ATPase of Neurospora crassaProposal for a proton pathway from the analysis of internal cavitiesOlivier Radresa1, Koji Ogata2, Shoshana Wodak2, Jean-Marie Ruysschaert1and Erik Goormaghtigh11Service ... characterized by the formation of a covalent enzyme-aspartyl phosphate intermediate[2,3,42,43].The 3D structures of PMA1_NEUCR and of anotherP-type ATPase, the Ca2+-ATPaseofrabbitsarcoplasmicreticulum ... Neurospora crassa plasma-membraneH+-ATPase; ATC1_RABIT, Oryctolagus cuniculus (rabbit) Ca2+-ATPase of sarcoplasmic reticulum (splice isoform SERCA 1a) .(Received 27 May 2002, revised 23 A ugust...
  • 13
  • 514
  • 0
Comparison of cosmetic earnings management for the developed markets and emerging markets  some empirical evidence from the united states and taiwan

Comparison of cosmetic earnings management for the developed markets and emerging markets some empirical evidence from the united states and taiwan

Báo cáo khoa học

... manage-ment may mislead stakeholders of the firm's corporate performance. This behavior can also explain the contractual behavior of seniormanagement using accounting data (Healy and Wahlen, ... don't have to estimate the potentially noisy abnormalaccruals (Healy and Wahlen, 1999). Another appealing feature is thatthe researchers can identify a large set of potential earningsmanipulators ... Business Management, College of Management, National Taipei University of Technology, Taipei, TaiwanbInstitute of Industrial and Business Management, College of Management, National Taipei University...
  • 8
  • 405
  • 0
Báo cáo sinh học:

Báo cáo sinh học: " Development and implementation of explicit computerized protocols for mechanical ventilation in children" pot

Hóa học - Dầu khí

... clinical data from the charts on diagnosis and use of sedatives and hemodynamic treatments. The mismatch between human ability and the vast amount of data and information contributes to variation ... the same way, as soon as a valid SpO2 is available. The ECP also will define how often the FiO2 can be changed, the amplitude of change, and add additional rules: for example, define what ... virtual patients with realistic physiological and pathological behaviors for developing and validating ECPs before clinical trials. Several teams are already working on such platforms, although...
  • 26
  • 435
  • 0
Báo cáo hóa học:

Báo cáo hóa học: " Optimization of capsid-incorporated antigens for a novel adenovirus vaccine approach" doc

Hóa học - Dầu khí

... NSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAA53RGD motif- SGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ63RGD motif- SNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQPEVEK73RGD motif- GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQPEVEKPQKKP83RGD ... GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQPEVEKPQKKP83RGD motif- TEQGGGGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQPEVEKPQKKPVIKPLCore Arg-Gly-Asp (RGD) ... CGGGATCCGCCGCGGCAATGCAGCC43RGD -(as) CGGGATCCGGCAGCTTCGGCCGCTG43RGD - (a) CGGGATCCAACTCCAACGCGGCAGCC53RGD -(as) CGGGATCCTTGCGCAGCGGGGGC53RGD - (a) CGGGATCCAGCGGCGCGGAAGAGAACTC63RGD -(as) CGGGATCCCTTCTCGACCTCGGGTTGCG63RGD...
  • 13
  • 419
  • 0
Báo cáo hóa học:

Báo cáo hóa học: " The equiconvergence of the eigenfunction expansion for a singular version of onedimensional Schrodinger operator with explosive factor" pptx

Hóa học - Dầu khí

... research center of AlexandriaUniversity.Author details1Department of Mathematics, Faculty of Education, Alexandria University, Alexandria, Egypt2Faculty of IndustrialEducation, Helwan University, ... AH Nasser2* Correspondence: zaki55@Alex-sci.edu.eg1Department of Mathematics,Faculty of Education, AlexandriaUniversity, Alexandria, EgyptFull list of author information isavailable at ... of 11 RESEARCH Open AccessThe equiconvergence of the eigenfunctionexpansion for a singular version of one-dimensional Schrodinger operator with explosivefactorZaki FA El-Raheem1*and AH...
  • 11
  • 260
  • 0
Báo cáo hóa học:

Báo cáo hóa học: " The equiconvergence of the eigenfunction expansion for a singular version of onedimensional Schrodinger operator with explosive factor" potx

Hóa học - Dầu khí

... Education, AlexandriaUniversity, Alexandria, EgyptFull list of author information isavailable at the end of the articleAbstractThis paper is devoted to prove the equiconvergence formula of the ... version of one-dimensional Schrodinger operator with explosivefactorZaki FA El-Raheem1*and AH Nasser2* Correspondence: zaki55@Alex-sci.edu.eg1Department of Mathematics,Faculty of Education, ... Faculty of Education, Alexandria University, Alexandria, Egypt2Faculty of IndustrialEducation, Helwan University, Cairo, EgyptAuthors’ contributionsThe two authors typed read and approved...
  • 11
  • 268
  • 0
báo cáo hóa học:

báo cáo hóa học:" Research Article Strong Convergence Theorems of Viscosity Iterative Methods for a Countable Family of Strict Pseudo-contractions in Banach Spaces" pot

Hóa học - Dầu khí

... Methods for a Countable Family of StrictPseudo-contractions in Banach SpacesRabian Wangkeeree and Uthai KamraksaDepartment of Mathematics, Faculty of Science, Naresuan University, Phitsanulok ... either a p-uniformly convexBanach space which admits a weakly continuous duality mapping or a p-uniformly convex Banachspace with uniformly Gˆateaux differentiable norm. As applications, at the ... Halpern, “Fixed points of nonexpanding maps,” Bulletin of the American Mathematical Society, vol.73, pp. 957–961, 1967.3 K. Aoyama, Y. Kimura, W. Takahashi, and M. Toyoda, “Approximation of...
  • 21
  • 379
  • 0
Báo cáo hóa học:

Báo cáo hóa học: " Research Article Convergence Comparison of Several Iteration Algorithms for the Common Fixed Point Problems" pot

Hóa học - Dầu khí

... Theory and Its Application, YokohamaPublishers, Yokohama, Japan, 2000.23 S. Reich, “Asymptotic behavior of contractions in Banach spaces,” Journal of Mathematical Analysis andApplications, vol. ... convergence theorems for resolvents of accretive operators in Banach spaces,”Journal of Mathematical Analysis and Applications, vol. 75, no. 1, pp. 287–292, 1980.7 W. Takahashi and Y. Ueda, “On Reich’s ... MathematicalAnalysis and Applications, vol. 241, no. 1, pp. 46–55, 2000.15 H K. Xu, “Viscosity approximation methods for nonexpansive mappings,” Journal of MathematicalAnalysis and Applications,...
  • 13
  • 280
  • 0
Báo cáo hóa học:

Báo cáo hóa học: "Research Article Strong Convergence Theorems of Common Fixed Points for a Family of Quasi-φ-Nonexpansive Mappings" ppt

Hóa học - Dầu khí

... theorems of a modified hybrid algorithm for a family of quasi-φ-asymptotically nonexpansive mappings,” Journal of Computational and Applied Mathematics,in press.25 Y. I. Alber, “Metric and generalized ... PanAmerican Mathematical Journal, vol. 4, no. 2, pp. 39–54, 1994.27 I. Cioranescu, Geometry of Banach Spaces, Duality Mappings and Nonlinear Problems, vol. 62 of Mathematics and Its Applications, ... family of relatively nonexpansive mappingsin a Banach space,” Journal of Mathematical Analysis and Applications, vol. 357, no. 2, pp. 356–363, 2009.9 G. Lewicki and G. Marino, “On some algorithms...
  • 11
  • 270
  • 0

Xem thêm