patient apos s history identify secondary htn due to medications and other substance use
A teacher's guide to interference and other problems
Ngày tải lên :
17/08/2013, 08:35
... applies to Swedes and some Norwegians The fall-rise tone is dif®cult for Scandinavian learners Norwegians (and some Swedes) tend to use too many rising tone units and to make their upglides too ... Speakers of Spanish and Catalan 90 Portuguese speakers 113 Greek speakers 129 Russian speakers 145 Polish speakers 162 Farsi speakers 179 Arabic speakers 195 Turkish speakers 214 Speakers of South ... English is said to or is supposed to) : *He shall be a poor researcher Another use of skal is to talk about arrangements (English is to or is going to) : *My daughter shall start school in August...
- 365
- 845
- 3
Energy savings due to daylight and artificial lighting integration in office buildings in hot climate
Ngày tải lên :
05/09/2013, 16:10
... from a survey questionnaire conducted to cover selected consultant offices in Dhahran area Since questionnaire surveys are limited by respondents' input and understanding, it is possible to encounter ... Architectural Systems (i.e Walls, Roofs and Windows) and Building lighting system - Design and Operate with Considerations to Energy Conservation, Indoor Thermal Environment (Visual, Thermal and Acoustical ... requirements in library facilities, Facilities, Vol (23), Issue 5/6 Page: 239 - 252, 2005) His research interests includes: - Design, Supervise, Maintain and Operate the following Systems: Architectural...
- 14
- 470
- 1
Health Education to Villages: An integrated approach to reduce childhood mortality and morbidity due to diarrhoea and dehydration; Maharashtra, India 2005 – 2010 pptx
Ngày tải lên :
22/03/2014, 15:21
... susceptible to these diseases, and 31% of all births in Maharashtra occur less than two years apart Compounding these dangerous factors, statistics show that mothers aged 15-19 are the most likely to ... providers, who must teach and reinforce its messages, and instruct mothers on how to use the card The current process of classroom trainings, however, will take several years for health workers to ... people to use the toilets, to create separate male and female toilets in schools, and to promote proper practices of hand washing with soap and water after using the toilet • Social mobilisation...
- 11
- 359
- 0
Báo cáo y học: "Molecular basis of telaprevir resistance due to V36 and T54 mutations in the NS3-4A protease of the hepatitis C virus" pdf
Ngày tải lên :
14/08/2014, 08:20
... to corroborate our findings The last section comprises a sequence analysis of HCV genotypes and their polymorphisms with respect to the mutational sites discussed in this study Analysis of NS3-4A ... PCACGSSDLYLVTRDADVIPARRRGDSTASLLSPRPLACLKGSSGGPVMCPSGHVAGIFRAAVCTRGVAKSLQFIPVETL PCTCGSSDLYLVTREADVLPARRRGDSTASLLSTRPLSCLKGSSGGPVMCPSGHVVGIFRAAVCTRGVAKALQFIPVETL PCTCGSSDLYLVTREADVLPARRRGDSTASLLSTRPLSCLKGSSGGPVMCPSGHVVGIFRAAVCTRGVAKALQFIPVETL ... analysis of MD simulation results, the average structures of the protease-inhibitor complexes of the last 100 ps of the simulations were used, superimposing backbone Cα atoms On the basis of these...
- 18
- 396
- 0
Báo cáo y học: "Cardiac surgery in a patient with retroperitoneal fibrosis and heart valvulopathy, both due to pergolide medication for Parkinson''''s disease" pps
Ngày tải lên :
10/08/2014, 10:20
... comparing patients with Parkinson 's disease and non-parkinsonian controls suggests that the risk of substantial valve regurgitation is 5-6 times higher in patients with Parkinson 's disease treated ... Japanese study in comparison to Europeans studies is unclear and may be related to the lower pergolide doses used in Asian patients There are only a few reported cases of patients who had surgery ... Fry A, Singh S, Gunda S, Boustead GB, Hanbury DC, McNicholas TA, Farrington K: Successful Use of Steroids and Ureteric Stents in 24 Patients with Idiopathic Retroperitoneal Fibrosis: A Retrospective...
- 3
- 308
- 0
Báo cáo y học: "Cerebral involvement in a patient with Goodpasture''''s disease due to shortened induction therapy: a case report" pdf
Ngày tải lên :
11/08/2014, 17:21
... diagnosis of cerebral vasculitis on the basis of a Goodpasture 's disease into account In an extensive metaanalysis for ANCA-associated vasculitides, it has been shown that pulsed immunosuppressive ... admission Regarding his past medical history, the patient was first treated for a rapid progressive glomerulonephritis (RPGN) in another hospital when Goodpasture 's disease was diagnosed histologically ... diseases such as Wegener 's granulomatosis or systemic lupus erythematosus [10] In our patient, Goodpasture 's disease was histologically established by kidney biopsy and proof of anti- Page of (page...
- 5
- 372
- 0
Children’s Health Deficits due to Diarrhoea: Effects of Water Supply and Sanitation Systems in Slums with Different Water Logging Conditions
Ngày tải lên :
05/09/2013, 10:15
... water Households using mixed sources of water Sanitation system Households using overhead hanging latrine Households using sanitary latrine Households using unsanitary latrine Households using no ... discussions on the immediate, underlying causes of health implications and ways to address these causes CONCLUSIONS DALYs lost varied considerably among the durations as well as for the types ... 2009) Septic tanks and pour-flush latrines connected to a sewer line were considered as sanitary latrines for the purpose of this study Unsanitary types consisted of cesspools, pit latrines and storage...
- 15
- 702
- 0
Tài liệu Bradford''''s History of ''''Plimoth Plantation'''' docx
Ngày tải lên :
20/02/2014, 09:20
... first Christian churches, as it was used in y^e Apostles times.[J] [6] So many therfore of these proffessors as saw y^e evill of these things, in thes parts, and whose harts y^e Lord had touched ... been enabled to take in this act of just and natural restitution In Massachusetts or out of Massachusetts there is no one more willing than I to assist this work; and here, sir [addressing Governor ... Bradford 's History of 'Plimoth Plantation', by William Bradford 11 Massachusetts and his successors, subject to a compliance with certain conditions, as set forth in said decree; And Whereas, The said...
- 238
- 426
- 0
Doctor and Patient, by S. Weir Mitchell pptx
Ngày tải lên :
06/03/2014, 15:20
... practice Rush was to some extent one of this class His book on insanity is far in advance of his time, and his descriptions of disease one of our best tests, most admirable Let us see how this physician ... lives, habits, and symptoms of the different people whose cases he has to treat From the rack of sickness sad confessions come to him, more, indeed, than he may care to hear To confess is, for ... aid this class of patients, are fully adequate to the purpose I was tempted when I wrote these essays to call them lay sermons, so serious did some of their subjects seem to me They touch, indeed,...
- 345
- 419
- 0
History of the Comstock Patent Medicine Business and Dr. Morse''''s Indian Root Pills, by Robert B. Shaw pot
Ngày tải lên :
15/03/2014, 17:20
... Comstock & Co., for in the summer of 1853 Lucius found it necessary to make an assignment of all of his assets to his creditors Thereafter he removed his business from John Street to 45 Vesey Street, ... Indian Root Pills (Smithsonian studies in history and technology, no 22) Bibliography: p Comstock (W.H.) Company I Title II Series: Smithsonian Institution Smithsonian studies in history and technology, ... Comstock & Brother, comprising George Wells Comstock, William Henry Comstock, and Baldwin L Judson, was formed on October 1, 1853 Judson was the husband of Eliza, a sister of Lucius and his brothers...
- 299
- 374
- 0
A Child''''s History of England pdf
Ngày tải lên :
17/03/2014, 13:20
... the Islanders for these metals, and gave the Islanders some other useful things in exchange The Islanders were, at first, poor savages, going almost naked, or only dressed in the rough skins of ... silk and cloth, and golden tissues and embroideries; dishes were made of gold and silver, brass and bone There were varieties of drinking-horns, bedsteads, musical instruments A harp was passed ... domineering strangers jingling their heavy swords and iron corselets up and down his house, eating his meat and drinking his strong liquor, stood in his doorway and refused admission to the first armed...
- 202
- 462
- 0
Froude''''s History of England potx
Ngày tải lên :
31/03/2014, 13:20
... it; to be less and less chivalrous to women, less and less respectful to old men, less and less ashamed of boasting about their sensual appetites; in a word, to show all those symptoms which, when ... historian into that of the novelist, a la Scott or Dumas The Parliament sometimes grants Henry 's demands: sometimes it refuses them, and he has to help himself by other means Why are both cases ... inestimable costs, charges, and expenses which the King 's Highness hath necessarily been compelled to support and sustain since his assumption to his crown, estate, and dignity royal, as well for...
- 25
- 275
- 0
Project Gutenberg’s History of Modern Mathematics, by David Eugene Smith pot
Ngày tải lên :
28/06/2014, 19:20
... determinants by Sylvester, Reiss, and Picquet; Jacobians and Hessians by Sylvester; and symmetric gauche determinants by Trudi Of the text-books on the subject Spottiswoode s was the first In America, ... Cauchy s conclusions, and gave 2! a completely scientific summation of the series for complex values of m and x He was emphatic against the reckless use of series, and showed the necessity of Cantor, ... Bessel s and Laplace s functions, but they are nevertheless looked upon as a distinct system of transcendents Tables of Bessel s functions were prepared by Bessel (1824), by Hansen (1843), and...
- 75
- 342
- 0
U.S. HISTORY ppsx
Ngày tải lên :
05/07/2014, 11:20
... authorities to find suitable quarters for British troops, in private homes if necessary Instead of subduing and isolating Massachusetts, as Parliament intended, these acts rallied its sister colonies to ... prosperous, so that Boston became one of America s greatest ports Oak timber for ships’ hulls, tall pines for spars and masts, and pitch for the seams of ships came from the Northeastern forests ... indentured servants, and every method from extravagant promises to actual kidnapping was used to take on as many passengers as their vessels could hold In other cases, the expenses of transportation and...
- 185
- 181
- 0
báo cáo khoa học: "Emergency adrenalectomy due to acute heart failure secondary to complicated pheochromocytoma: a case report" docx
Ngày tải lên :
09/08/2014, 01:24
... CT scan revealed a left adrenal mass measuring roughly cm and displaying focal necrosis (figure 2); the diagnosis was suspected complicated pheochromocytoma Due to hemodynamic instability and ... hypotension which responded well to crystalloid infusion Disscusion Although pheochromocytomas are rare tumors, a relatively high prevalence (up to 0.05%) has been reported in autopsy studies, suggesting ... adrenoceptor blockers Metirosine (alpha-methyl-paratyrosine), which blocks catecholamine synthesis, is also occasionally used Medical treatment usually lasts for around 10-14 days The alpha-adrenoceptor...
- 5
- 346
- 0
Báo cáo khoa học: "Gastric outlet obstruction due to adenocarcinoma in a patient with Ataxia-Telangiectasia syndrome: a case report and review of the literature" pdf
Ngày tải lên :
09/08/2014, 04:21
... tendency to form glandular structures and spreads to distant organs hematogenously The diffuse type is typically poorly differentiated, lacks gland formation and is composed of signet ring cells Early ... review, and critical review of the manuscript; SH was responsible for all aspects of the manuscript related to the histologic studies; GEB was involved in the patient' s initial operation, and assisted ... pain, nausea, vomiting and weight loss Three patients including ours had initial clinical findings suggestive of ulcer disease On endoscopy, our patient was noted to have diffuse gastritis, which...
- 5
- 598
- 0
báo cáo khoa học: "Transient psychosis due to painless thyroiditis in a patient with anxiety disorder: a case report" pdf
Ngày tải lên :
10/08/2014, 23:21
... anxiety disorder recovered without any psychotropic agents Discussion Painless thyroiditis consists of self-limited thyrotoxicosis It follows transient hypothyroidism in some cases and occurs during ... course of Hashimoto s thyroiditis or Graves’ disease in remission The hyperthyroidism in this disease is usually mild and is often unnoticed At first, we thought that the delusions in our patient ... destructive thyroiditis In 1998, Bokhari et al reported a case with postpartum thyroiditis and psychosis [5] Because postpartum psychosis is a common disease, thyroiditis and psychosis may have cooccurred...
- 4
- 362
- 0