observed neutrophil depolarization and g protein mediated calcium mobilization by surfactant with sp b c

Tài liệu Báo cáo khoa học: Regulators of G-protein signalling are modulated by bacterial lipopeptides and lipopolysaccharide pptx

Tài liệu Báo cáo khoa học: Regulators of G-protein signalling are modulated by bacterial lipopeptides and lipopolysaccharide pptx

Ngày tải lên : 18/02/2014, 13:20
... (anti-sense); muRGS2 5¢-GAGAAAATGAAGCGGACACTCT-3¢ (sense), 5¢-TTG CCAGTTTTGGGCTTC-3¢ (antisense); muHPRT as housekeeping gene 5¢-ACTTTGCTTTCCCTGGTTA-3¢ (sense), 5¢-CAAAGTCTGGCCTGTATCC-3¢ (antisense); ... (antisense); muTNF-a 5¢-GACCCTCACACTCAGATCATCTTC-3¢ (sense), 5¢-CC ACTTGGTTTGCTACGA-3¢ (antisense) Acknowledgements We appreciate the excellent technical assistance of Suhad Al-Badri and < /b> Franziska Daduna ... primer, 1· LightCyclerÒ Fast Start DNA MasterPlus SYBR Green I mix (Roche Diagnostics) The following primers were used: muRGS1 5¢-TCTGCTAGCCCAAAGGATTC-3¢ (sense), 5¢TTCACGTCCATTCCAAAAGTC-3¢ (anti-sense);...
  • 11
  • 569
  • 0
Báo cáo khoa học: Activation of nematode G protein GOA-1 by the human muscarinic acetylcholine receptor M2 subtype Functional coupling of G-protein-coupled receptor and G protein originated from evolutionarily distant animals doc

Báo cáo khoa học: Activation of nematode G protein GOA-1 by the human muscarinic acetylcholine receptor M2 subtype Functional coupling of G-protein-coupled receptor and G protein originated from evolutionarily distant animals doc

Ngày tải lên : 07/03/2014, 11:20
... template with < /b> the following primers: M2-myc-EcoRI-s, 5¢-CAGAATTCatg gagcagaagctgatctccgaggaggacctgctgGTGAACAACTCCAC CAACTCCTCCAACAACTCCCTGGCTCTTACAAGTC CTTATAAGACA-3¢; HsM2-as, 5¢-TTACCTTGTAGCG CCTATGTTCTTATAATG-3¢ ... primers: M2-goa1-s, 5¢-CATTATAAGA ACATAGGCGCTACAAGGATGGGTTGTACCATGTC ACAGGAAG-3¢; M2-goa1-PstI-as, 5¢-CCAATGCATTGG TTCTGCAGTTAATACAAGCCGCATCCACGAAGA-3¢ (An engineered PstI recognition site is single-underlined ... as a Gai ⁄ ocoupled receptor since its primary structure determination in 1986 [23] Although Gb and < /b> Gc are essential for Ga activation by < /b> GPCR [10], GPCR can activate Ga without Gb and < /b> Gc in...
  • 9
  • 400
  • 0
Báo cáo hóa học: " Surface Modification and Planar Defects of Calcium Carbonates by Magnetic Water Treatment" pptx

Báo cáo hóa học: " Surface Modification and Planar Defects of Calcium Carbonates by Magnetic Water Treatment" pptx

Ngày tải lên : 21/06/2014, 08:20
... nanoparticles Stability and < /b> Growth Habit of Aragonite Speci c physio-chemical and < /b> biological conditions of aqueous solution may cause metastable formation of the high-pressure phase of calcium < /b> carbonate, ... with < /b> decreasing size Note Ca and < /b> C (representing CO32-) atoms with < /b> point charges account for the cation–anion mixed surfaces in both (a) and < /b> (b) , and < /b> a face-centered rhombohedron pseudocell including ... indicated by < /b> 2-D forward and < /b> inverse 41] Fourier transform in Fig 7b and < /b> c, respectively This accounts for {11" 20}- and < /b> {10" 14}-speci c coalescence of such shaped calcite nanoparticles into particulates...
  • 10
  • 292
  • 0
Báo cáo y học: "Decreased levels of soluble amyloid β-protein precursor and β-amyloid protein in cerebrospinal fluid of patients with systemic lupus erythematosus" ppsx

Báo cáo y học: "Decreased levels of soluble amyloid β-protein precursor and β-amyloid protein in cerebrospinal fluid of patients with systemic lupus erythematosus" ppsx

Ngày tải lên : 09/08/2014, 01:23
... measure of intrathecal IgG production and < /b> calculated using the formula: IgG index = CSF – IgG (mg/l) / S – IgG (g/< /b> l) CSF – albumin (mg/l) / S – albumin (g/< /b> l) (normal value < 0.7) All CSF samples were ... also analyzed by < /b> isoelectric focusing to permit detection of oligoclonal IgG bands These bands represent the brain-infiltrating oligoclonal B- cell population MRI analyses Neuroimaging was performed ... to brain magnetic resonance imaging (MRI)-verifiable changes, and < /b> in cerebrally healthy control subjects (d) CSF content of transforming growth factor beta (TGF-β) in SLE patients stratified with...
  • 8
  • 342
  • 0
Báo cáo y học: "Discovering and validating unknown phosphosites from p38 and HuR protein kinases in vitro by Phosphoproteomic and Bioinformatic tools" doc

Báo cáo y học: "Discovering and validating unknown phosphosites from p38 and HuR protein kinases in vitro by Phosphoproteomic and Bioinformatic tools" doc

Ngày tải lên : 10/08/2014, 09:22
... which belong to HuR RNA binding protein < /b> gi/ 1022961 and;< /b> R.TAVINAASGR.Q which belongs to Chain B, Structure Of Appbp1-Uba3-nedd8-MgatpUbc12 (c1 11a), A Trapped Ubiquitin-Like Protein < /b> Activation Complex ... TAVINAASGR.Q which belongs to Chain B, Structure Of Appbp1-Uba3-nedd8-Mgatp-Ubc12 (c1 11a), A Trapped Ubiquitin-Like Protein < /b> Activation Complex gi/ 126031226 (Table 1) (c) SIMAC coupled to MAS and < /b> MS3-NL ... were carried out by < /b> CID We hypothesize that combining CID with < /b> ETD or ECD fragmentation, it is probable that more and/< /b> or complementary data would be obtained according to the methodological study...
  • 16
  • 265
  • 0
Báo cáo khoa học: Ion-binding properties of Calnuc, Ca2+ versus Mg2+ – Calnuc adopts additional and unusual Ca2+-binding sites upon interaction with G-protein pdf

Báo cáo khoa học: Ion-binding properties of Calnuc, Ca2+ versus Mg2+ – Calnuc adopts additional and unusual Ca2+-binding sites upon interaction with G-protein pdf

Ngày tải lên : 07/03/2014, 00:20
... any CD spectral signature, it showed a biphasic signature in both the J-band and < /b> the c- band regions (Fig 6B) on binding to the protein < /b> CD results confirmed the absorbance data: Ca2+ binding is able ... binding to Calnuc, the dye displayed prominent J-band and < /b> c- band in both absorption and < /b> CD spectra (Fig 6A ,B) Furthermore, Ca2+ ‘competes off’ the dye (attenuating both the J-band and < /b> the c- band), ... change of the CD signal was observed < /b> upon binding with < /b> GDP-bound G-< /b> protein,< /b> whereas an increase in the J-band intensity was elicited upon interaction of Calnuc and < /b> GTP-bound G-< /b> protein < /b> (Fig 8B) ...
  • 18
  • 333
  • 0
Báo cáo khoa học: NBR1 interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB) and shows developmentally restricted expression in the neural tube pptx

Báo cáo khoa học: NBR1 interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB) and shows developmentally restricted expression in the neural tube pptx

Ngày tải lên : 08/03/2014, 10:20
... pGBT9NBR1216 (iii) pGBT9NBR1333 (iv) pGBT9NBR 1C term (v) pGBT9NBR 1c1 (vi) pGBT9NBR 1c2 (vii) pGBT9NBR 1c3 , viii) pGBT9NBR 1c4 or (ix) pGBKT7CIB and < /b> tested for protein< /b> protein < /b> interaction by < /b> a colony ... 1±333), pGBT9NBR 1c1 (amino acids 340±453), pGBT9NBR 1c2 (amino acids 451±597), pGBT9NBR 1c3 (amino acids 592±754) and < /b> pGBT9NBR 1c4 (amino acids 748±910) A BclI fragment of pGBT9NBR1 was subcloned ... as protein < /b> products of both pGBT9NBR1333 and < /b> pGBT9NBR1Cterm were able to interact with < /b> full-length NBR1 (see Fig 1B, i,iii,iv and < /b> vi) FEZ1 and < /b> CIB interact with < /b> each other To con®rm the interactions...
  • 8
  • 421
  • 0
Báo cáo khoa học: G protein-coupled receptor-induced Akt activity in cellular proliferation and apoptosis pptx

Báo cáo khoa học: G protein-coupled receptor-induced Akt activity in cellular proliferation and apoptosis pptx

Ngày tải lên : 16/03/2014, 05:20
... p11 0b or p11 0c subunits, and < /b> that this activation is mediated < /b> by < /b> Gbc subunits, but not by < /b> Ga subunits [20] Direct activation of PI3K by < /b> Ga subunits has not been specifically measured but they can ... of G < /b> protein,< /b> activate PI3K ⁄ Akt pathways through either Ga or Gbc subunits (see below, Table and < /b> Fig 1) Gbc subunits are able to bind directly to and < /b> activate PI3K heterodimeric proteins containing ... Journal compilation ª 2007 FEBS 6031 Regulation of Akt signaling pathways by < /b> GPCRs D C New et al dendrocytes, carbachol (a nonselective muscarinic receptor agonist) significantly reduces caspase-mediated...
  • 12
  • 392
  • 0
Báo cáo khoa học: G protein-coupled receptor 30 down-regulates cofactor expression and interferes with the transcriptional activity of glucocorticoid pdf

Báo cáo khoa học: G protein-coupled receptor 30 down-regulates cofactor expression and interferes with the transcriptional activity of glucocorticoid pdf

Ngày tải lên : 16/03/2014, 18:20
... primer 5¢-ATCTCCAAGGCAA GATCA-3¢ and < /b> reverse primer 5¢-GTGCCATCAGA CAAGGAA-3¢ were used Primer pair resulted in a PCR product of 216 bp Additionally, forward primer 5¢-GAGCCCCAAGAAGAAAGA-3¢ and < /b> reverse ... 5¢-ATTATTGGATC CTACACGGCACTGC-3¢ Viruses capable of introducing pLEGFP-N1, pLEGFP-N1/GPR30, pL-N1 and < /b> pL-N1/ GPR30 vectors were established in the PT67 packaging cell line derived from ATCC (American ... of GR activity by < /b> growth factors and < /b> cAMP is well established, and < /b> in most cases requires the presence of glucocorticoid The role of GPR in glucocorticoid -mediated < /b> signaling was suggested by < /b> Schmidt...
  • 10
  • 389
  • 0
Báo cáo khoa học: The impact of G-protein-coupled receptor hetero-oligomerization on function and pharmacology pptx

Báo cáo khoa học: The impact of G-protein-coupled receptor hetero-oligomerization on function and pharmacology pptx

Ngày tải lên : 16/03/2014, 22:20
... 2005 FEBS R Maggio et al Function and < /b> pharmacology of hetero-oligomers A B H GPCR GPCR H GPCR H H β-arrestin H GPCR H H GPCR GPCR H GPCR GPCR β-arrestin No effect No effect H GPCR H GPCR H GPCR β-arrestin ... drug specificity by < /b> developing dimeric ligands capable of acting as bivalent ligands The first publication showing the feasibility of constructing a bivalent ligand directed to heterodimeric receptors ... pertussis-sensitive Gi ⁄ Go-proteins to pertussis-insensitive (probably Gz) proteins, in transiently cotransfected COS-7 cells [13]; (b) chemokine CCR 2b and < /b> CCR5 receptors that gained coupling selectivity for G1< /b> 1-protein...
  • 8
  • 488
  • 0
Báo cáo khoa học: The study of G-protein coupled receptor oligomerization with computational modeling and bioinformatics doc

Báo cáo khoa học: The study of G-protein coupled receptor oligomerization with computational modeling and bioinformatics doc

Ngày tải lên : 16/03/2014, 22:20
... sequence changes that occur during evolution at the interaction interface of a given protein < /b> (Fig 2B) must be compensated by < /b> changes in the interacting protein < /b> (Fig 2C) to preserve the protein< /b> protein < /b> ... sorted by < /b> decreasing correlation values (from to 0) To increase the chance of obtaining correctly predicted contacts, only highly correlated pairs are taken into account for each case This is achieved ... Pittsburgh Supercomputing Center The authors also acknowledge access to the computer and < /b> bioinformatics facilities at the Institute of Computational Biomedicine (ICB) of Weill Medical College The...
  • 13
  • 515
  • 0
Báo cáo khoa học: K182G substitution in DevR or C8G mutation in the Dev box impairs protein–DNA interaction and abrogates DevR-mediated gene induction in Mycobacterium tuberculosis doc

Báo cáo khoa học: K182G substitution in DevR or C8G mutation in the Dev box impairs protein–DNA interaction and abrogates DevR-mediated gene induction in Mycobacterium tuberculosis doc

Ngày tải lên : 22/03/2014, 16:20
... CACGCACTCACTACCGATCACA GAAAAGACGGTGGGGAACTACGTGTCG CGACACGTAGTTCCCCACCGTCTTTTC GAAAAGACGGTGGCGAACTACGTGTCG CGACACGTAGTTCGCCACCGTCTTTTC TGACGAATAAGGCGTTTGGTCCTTTCC GGAAAGGACCAAACGCCTTATTCGTCA TGACGAATAAGGCCATTGGTCCTTTCC ... TGACGAATAAGGCCATTGGTCCTTTCC GGAAAGGACCAATGGCCTTATTCGTCA TGACGAATAAGGCGATTGGTCCTTTCC GGAAAGGACCAATCGCCTTATTCGTCA This study S D Majumdar, PhD thesis submitted to AIIMS, 2010 This study This study [27] S Ghosh, ... Sequence 5¢ fi 3¢ fdxA tsp fdxA f fdxA r K18 2G < /b> f K18 2G < /b> r K182A f K182A r fdxA -C 8G < /b> f fdxA -C 8G < /b> r fdxA-A9T f fdxA-A9T r fdxA -C 8G-< /b> A9T f fdxA -C 8G-< /b> A9T r CCAGTAGATCGCCT TGACGGGCTATCGTAAGTTTATG CACGCACTCACTACCGATCACA...
  • 9
  • 351
  • 0
Báo cáo khoa học: C-terminal truncated cannabinoid receptor 1 coexpressed with G protein trimer in Sf9 cells exists in a precoupled state and shows constitutive activity ppt

Báo cáo khoa học: C-terminal truncated cannabinoid receptor 1 coexpressed with G protein trimer in Sf9 cells exists in a precoupled state and shows constitutive activity ppt

Ngày tải lên : 23/03/2014, 07:20
... full-length CB1 gene, with < /b> EcoRI and < /b> NotI restriction sites, was 5¢-GAA T GC GGC CGC TCA CTT TTC GAA TTG AGG GTG CGA CCA GAA TTC AGC CTC GGC AGA CGT GTC TGT GGA-3¢, which contains the StrepII tag between ... baculovirus transfer vector with < /b> the mellitin signal sequence The forward primer for the CB1 gene with < /b> the BamHI restriction site was 5¢-GC G < /b> GAT CC G < /b> ACC ATG GCG AAG TCG ATC CTA GAT GGC-3¢ The reverse ... FHTCB1(417)-YFP (acceptor) and < /b> Gi1-CFP (donor) fusion proteins Sf9 cells coexpressing FHTCB1(417)-YFP, Gi1-CFP and < /b> b1 c2 were imaged using a laser scanning confocal microscope No cannabinoid ligands...
  • 10
  • 313
  • 0
Báo cáo khoa học: Alanine screening of the intracellular loops of the human bradykinin B2 receptor – effects on receptor maintenance, G protein activation and internalization pdf

Báo cáo khoa học: Alanine screening of the intracellular loops of the human bradykinin B2 receptor – effects on receptor maintenance, G protein activation and internalization pdf

Ngày tải lên : 29/03/2014, 23:20
... at the indicated times by < /b> putting the plates back on ice and < /b> washing the cells four times with < /b> ice-cold NaCl ⁄ Pi Subsequently, surface-bound [3H]BK was dissociated by < /b> incubating the cell monolayers ... 37 C was followed by < /b> an additional incubation on ice After 90 min, these cells were also rinsed with < /b> ice-cold NaCl ⁄ Pi and < /b> [3H]BK binding was measured as described above Nonspeci c binding was ... the connection between the structure of ICLs and < /b> that of the binding site, implying reciprocally that changes at the binding site through binding of an (inverse) agonist could also induce conformational...
  • 13
  • 322
  • 0
g protein signaling, methods and protocols

g protein signaling, methods and protocols

Ngày tải lên : 10/04/2014, 22:24
... Sf9 cells, but not from E coli, is critical for the interaction with < /b> adenylyl cyclase Gqα has slow GDP–GTP exchange rate and < /b> cannot be activated by < /b> incubation with < /b> buffer F In contrast, endogenous ... provided by < /b> NIH training grant DA07255 (JAB) Expression and < /b> Purification of Soluble AC 51 Fig Purified 7C1 a, 7C2 a, and < /b> 7C 1b- 4h g < /b> 7C1 a, g < /b> 7C2 , and < /b> 7C 1b- 4h were run on 15% SDS-PAGE gel and < /b> stained with < /b> ... GTP-bound Gqα by < /b> simply incubating Gqα with < /b> GTP The agonist-activated receptor is usually required to facilitate the GDP–GTP exchange of Gqα (21) GqαR18 3C mutant in which arginine183 in switch...
  • 233
  • 306
  • 0
Báo cáo y học: "Common principles and intermediates of viral protein-mediated fusion: the HIV-1 paradigm" pps

Báo cáo y học: "Common principles and intermediates of viral protein-mediated fusion: the HIV-1 paradigm" pps

Ngày tải lên : 13/08/2014, 05:21
... 164 Chami M, Oules B, Paterlini-Brechot P: Cytobiological consequences of calcium-< /b> signaling alterations induced by < /b> human viral proteins Biochim Biophys Acta 2006, 1763:1344-1362 165 del Real G,< /b> ... membrane merger, the fusion must be captured at physiological temperature Disparate biological fusion reactions converge to a common lipid-dependent stage that can be reversibly blocked by < /b> incorporating ... interactions of gp120 with < /b> CD4 and < /b> coreceptors, CCR5 or CXCR4 [16,18,51,90] Binding to CD4 alters the structure and < /b> conformational flexibility of gp120 resulting in formation of the coreceptor binding site...
  • 13
  • 242
  • 0
Báo cáo y học: " Signaling and regulation of G protein-coupled receptors in airway smooth muscle" ppsx

Báo cáo y học: " Signaling and regulation of G protein-coupled receptors in airway smooth muscle" ppsx

Ngày tải lên : 13/08/2014, 13:20
... Gq Gq Gq, Gi, G1< /b> 2/13 Gs Gq Gs CXN, GP CXN, GP GS, Cyt RLXN, GI, Cyt CXN, GP GI m2 muscarinic m3 muscarinic NK-1/2 PAR-1,2,3 [21,251,252] [251–256] [257–260] [34,261,262] Gi Gq Gq Gq, Gi, G1< /b> 2/13 ... from receptor-operated calcium < /b> channels can contribute The rise in intracellular calcium < /b> promotes calcium < /b> binding to calmodulin forming calcium-< /b> calmodulin complexes that activate myosin light chain ... in ASM Regulation of GPCR signaling Signaling by < /b> GPCRs is a highly regulated process One critical way in which a cell controls its response to extracellular GPCR ligands is through regulation...
  • 23
  • 363
  • 0
Characterization and function of two g protein regulators, vertebrate LGN and drosophila RapGAP

Characterization and function of two g protein regulators, vertebrate LGN and drosophila RapGAP

Ngày tải lên : 12/09/2015, 09:42
... G-< /b> actin Globular actin GDI Guanine Dissociation Inhibitor GEF Guanine Exchange Factor GIPs Inhibitory G-< /b> proteins GM130 golgi matrix protein < /b> 130KD GoLoco G< /b> i/o – Loco interaction motif GPCR G-< /b> Protein < /b> ... of GDP, thus implying a type of GDI activity for G< /b> γ dimer Ligand-occupied GPCRs stimulate signal onset by < /b> acting as guaninenucleotide exchange factors (GEFs) for G< /b> subunits, thereby facilitating ... the standard model of heterotrimeric G < /b> protein < /b> signaling, GPCRs are associated with < /b> the membrane bound heterotrimeric G-< /b> proteins comprising of G< /b> , G< /b> and < /b> G< /b> subunit In the absence of ligand-mediated...
  • 221
  • 300
  • 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 1

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 1

Ngày tải lên : 14/09/2015, 09:13
... of the GTP by < /b> the G< /b> intrinsic GTPase activity, which can be accelerated by < /b> regulator of G < /b> protein < /b> signaling (RGS), leads to the replacement of GTP with < /b> GDP and < /b> reassociation of G< /b> with < /b> G< /b> γ heterodimer, ... better understanding of G < /b> protein < /b> signaling functions in plants The genomes of diploid plant species encode single canonical G < /b> alpha subunit and < /b> G < /b> beta subunit proteins: Gpa1 and < /b> Agb1 in Arabidopsis, ... corresponding rice orthologs are Rgg1 and < /b> Rgg2 (Mason and < /b> Botella 2000; Kato et al 2004) G < /b> proteins regulate ion channels and < /b> abscisic acid (ABA) signaling in Arabidopsis guard cells The gpa1∆...
  • 220
  • 228
  • 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 2

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 2

Ngày tải lên : 14/09/2015, 09:24
... A B HPH1 RGS1 Figure 21 A rgs1D WT Rgs1 OP Complemented B WT rgs1D Complemented Rgs1 OP _ Figure 22 Inductive Non-inductive _ Figure 23 WT rgs1D Complemented Figure 24 Figure 25 Figure 26 Rgs1 ... STTS -MDGIKEIMAQAYGIYNAFLAPGSPCELNIDHQLRSNLATRMTKAVGQ -ADAVRETLAAAYGLYNAFLAPGSPCELNIDHALRNSLASRMTKAVGD LSNENCSFKKQGFKHQLKEYKPAPLTLAETHSPNASVENSHTIVRYGMDNTQNDTKSVES Rgs1 Cprgs-1 FlbA Sst2 ... ESPRNTMQLVNLERDTETDKLSHDRATIEVIFRRFAGQDGPNVKSSISTSDSDSLSDYSN FQISRSSFFTLSKRGWDLVSWTGCKSNNIRAPNGSTIDLDFTLRGHMTVRDEKKTLDDSE Rgs1 Cprgs-1 FlbA Sst2 408 213 420 406 GLTGVKMAPERKVNGKIHKDTFTGK-AASEWLMDCCTTVDRREAVEIASLFVEYELIEAL GLTGVKMAAERKIGGKTYKETFTGK-AATDWLMDCSTTVDRRETVEIASYFVEFGLMECV...
  • 12
  • 185
  • 0