numerical integration of newton s equation for a sho 489
Báo cáo hóa học: " Research Article A Refinement of Jensen’s Inequality for a Class of Increasing and Concave Functions" pptx
Ngày tải lên :
22/06/2014, 03:20
... Peˇ ari´ , F Proschan, and Y L Tong, Convex Functions, Partial Orderings, and Statistical Applications, c c vol 187 of Mathematics in Science and Engineering, Academic Press, Boston, Mass, USA, ... right-hand side above, we can choose any θ1 satisfying ≤ θ1 ≤ μ1 For n > 2, let us suppose that 1.3 has been proved for up to n − 1, and consider the case of n Fix x1 , , xn We may assume that ... the statement of Theorem 1.2 makes the assumption that this is true for all possible weight vectors The following lemma gives a simple sufficient condition for this assumption to hold Lemma 1.4...
- 14
- 373
- 0
Báo cáo toán học: " A q-Analogue of Faulhaber’s Formula for Sums of Powers" doc
Ngày tải lên :
07/08/2014, 08:22
... derives his formulas from the machinery of basic hypergeometric series For example, for the q-analogues of the sums of quarts and quints, he first specializes Bailey s terminating very-well-poised ... the above formulas have the same pattern that each summand on the righthand side has no pole at q = 1, and so reduce directly to Faulhaber s corresponding formulas when q → At the end of his paper, ... Recently, the problem of q-analogues of the sums of powers has attracted the attention of several authors [2, 9, 8], who found, in particular, q-analogues of the Faulhaber formula corresponding to m...
- 19
- 404
- 0
Báo cáo toán học: "A Refinement of Cayley’s Formula for Trees" doc
Ngày tải lên :
07/08/2014, 08:22
... isomorphism class of ordered forests on n vertices corresponds to n! labeled ordered forests An unlabeled forest is formally defined as an isomorphism class of forests, but we think of an unlabeled forest ... elements of K as cars and the elements of [n + 1] as parking spaces and we think of f as a function that assigns to each car its favorite parking space The cars arrive in some order at their favorite ... 12 A different symmetry of forests that has a very similar special case is described in [7] (See also [10].) Since the proper vertices of a forest are the same as the proper vertices of its component...
- 23
- 228
- 0
Báo cáo toán học: "MacMahon’s theorem for a set of permutations with given descent indices and right-maximal record" ppt
Ngày tải lên :
08/08/2014, 12:22
... permutations and derivation therefrom of functions of a single variable associated with the permutations of any assemblage of objects, Amer J Math., 35(1913), 281-322 [11] P A MacMahon, Two applictions ... journal of combinatorics 17 (2010), #R34 Recall that the algebra Sym of noncommutative symmetric functions is the free associative algebra, on the symbol set Sn , whose basis is given by S I = Si1 ... Sin for all compositions I = (i1 , , ir ) [5] When A is an ordered alphabet, Sn (A) can be realized as the sum of all nondecreasing words in An The commutative image of Sym is the algebra...
- 14
- 415
- 0
A facile construction of the tricyclic 5 7 6 scaffold of fungi derived diterpenoids the rst total synthesisof (±) heptemerone g and a new approach to danishefsky s intermediate for a guanacastepene
Ngày tải lên :
26/01/2016, 09:27
... comparison To complete the formal synthesis of guanacastepene A (1), diol 24 was dissolved in acetone and treated with a catalytic amount of p-toluenesulfonic acid Compound was obtained (crystalline ... broadening of some signals was observed in its 13C NMR spectrum, presumably due to the conformational flexibility of this compound. 2a, 3a No spectrum of the natural compound was available for a ... first total synthesis of (±)-heptemerone G (2) and in a synthesis of the (±)-guanacastepene precursor Key features of the synthesis include an efficient new synthetic sequence for annulation of...
- 3
- 547
- 0
Application of house’s model for translation quality assessment in assessing the english version of the vietnam’s law on investment no. 59/2005/qh11
Ngày tải lên :
07/11/2012, 14:36
... methods and strategies of translation, as well as assessment and evaluation of translations This study aims at revealing the most basic features of Vietnamese and English legal language, and basic ... translation of the Law on Investment of Vietnam Therefore, a set of parameters for assessment is necessary Among the various criteria and models for translation quality assessment, House s model is ... concepts of translation theory in general, legal translation in particular Then it will test the appropriateness of House s model for translation quality assessment in assessing English translations...
- 86
- 896
- 5
SIMULATION AND VERIFICATION OF PARTICLE COAGULATION DYNAMICS FOR A PULSED INPUT
Ngày tải lên :
05/09/2013, 08:40
... well as the loss of particles of size k should be incorporated into the integration of the simulation process (Hounslow et al., 1988) Fractal Aggregates Aggregates formed by coagulation are highly ... fractal dimension A fractal aggregate with D
- 6
- 509
- 0
Tài liệu NIEHS/EPA Children’s Environmental Health and Disease Prevention Research Centers: Protecting Children’s Health for a Lifetime pptx
Ngày tải lên :
12/02/2014, 19:20
... are established by NIEHS and EPA, with a research emphasis on children s asthma and other respiratory diseases, as well as ways to reduce exposure to pesticides for children in agricultural settings ... makers in the shared goal of advancing the impact of environmental public health research 5-Year Grants These larger grants are awarded to research institutions to assemble teams of multidisciplinary ... interactions among basic scientists, clinicians and behavioral and social scientists n Generate data from multiple scientific disciplines to understand the persistent effects of chemicals and other...
- 4
- 412
- 0
Mental health aspects of women’s reproductive health: A global review of the literature pdf
Ngày tải lên :
06/03/2014, 02:20
... relationships and lack of assistance in crises, is related to postpartum depression General dissatisfaction with available support, rather than specific characteristics or number or quality of ... A, eds., Psychosocial aspects of depression New Jersey, Lawrence Erlbaum and Associates Kumar R (1994) Postnatal mental illness: a transcultural perspective Social Psychiatry and Psychiatric ... evidence is currently available, Adamson (1996) has suggested that parasuicide and suicide may also be consequences of the profound distress that accompanies vesicovaginal fistula in women in some...
- 181
- 484
- 0
Overview of Trastuzumab’s Utility for Gastric Cancer pdf
Ngày tải lên :
06/03/2014, 02:21
... Annual meeting of ASCO 2007; (aLBA4513T) 10 Imamura H, IIishi H, Tsuburaya A, et al Randomized phase III study of irinotecan plus S- 1 (IRIS) versus S- 1 alone as first-line treatment for advanced ... signal transduction in cellular processes, such as proliferation, differentiation, and cell survival Aberrant HER2 expression or function has been associated in carcinogenesis of breast, gastric, ... regulation and subsequent degradation in HER2 over-expressing cancer cells Intracellular Mechanisms: Inhibits intracellular signaling pathways, phosphoinositide 3-kinase (PI3K) signaling such as...
- 6
- 474
- 0
Báo cáo khoa học: "Probabilistic Integration of Partial Lexical Information for Noise Robust Haptic Voice Recognition" doc
Ngày tải lên :
07/03/2014, 18:20
... remaining 50 sentences were used for acoustic model adaptation These sentences contain a variety of given names, surnames and city names so that confusions cannot be easily resolved using a language ... topology and three emitting states The emission probability for each state is represented by a single Gaussian component A bigram language model with a vocabulary size of 200 words was used for testing ... concurrently According to this study, synchronous keyboard input speed is 86 words per minutes (WPM) This is Higher SNR indicates a better speech quality A single Gaussian component system was used as a...
- 9
- 506
- 0
THE PRESIDENT’S PLAN FOR A STRONG MIDDLE CLASS & A STRONG AMERICA pptx
Ngày tải lên :
08/03/2014, 06:20
... EMBARGOED UNTIL DELIVERY OF THE PRESIDENT S STATE OF THE UNION ADDRESS The President s Plan for A Strong Middle Class & A Strong America A thriving middle class has always been America s engine ... at risk with volatile gas prices straining the budgets of middle class families In the last four years, America has slashed our reliance on foreign oil and dramatically increased American production ... these efforts, the Administration will host a SelectUSA Investment Summit this year, matching businesses from around the world with local leaders to attract jobs and investment to our shores Slashing...
- 9
- 438
- 0
Báo cáo "Numerical study of long wave runup on a conical island " pdf
Ngày tải lên :
14/03/2014, 15:20
... waves. The model also has potential features to apply to the study of practical problems related to long waves, such as inundation of tsunami on coastal areas. Simulated ... Coastal and Ocean Engineering 113 (1987) 282. [4] N. Kobayashi, G .S. DeSilva, K.D. Wattson, Wave transformation and swash oscillations on gentle and steep slopes, Journal of Geophysics ... This was the ninth‐deadliest natural disaster in modern history. Indonesia, Sri Lanka, India, Thailand, and Myanmar were hardest hit. Field surveys of tsunami damage on both Babi and Okushiri Islands showed unexpectedly ...
- 9
- 556
- 0
Báo cáo Y học: Modeling the three-dimensional structure of H+-ATPase of Neurospora crassa Proposal for a proton pathway from the analysis of internal cavities pptx
Ngày tải lên :
23/03/2014, 21:20
... the same position in ATC1_RABIT (data not shown) Aside from mutations directed against a small stretch of amino acids adjacent to the phosphorylated Asp [54], limited information is available ... the positions of internal polar cavities that are large enough to contain at least one water molecule Analyses of X-ray structures of soluble proteins have indeed shown that such cavities usually ... yeast H+-ATPase is found close to cavity number 10, a small internal cavity that appears as nonpolar in our model Nevertheless mutagenic studies in yeast H+-ATPase revealed that substitution at...
- 13
- 514
- 0
Báo cáo khoa học: "An Extension of Earley''''s Algorithm for S-Attributed Grammars" pdf
Ngày tải lên :
01/04/2014, 00:20
... shown more explicitly as A= A [A. al A. an] As the state enters the completer, the attribute occurrences A. ai of A are unevaluated; however, since the grammar is S- attributed it is easy to show ... conditions, as above The base grammar G assigns a derivation tree x to each sentence in L(G) The tree is annotated at each node labelled X with the set A( X) of attributes associated with X; each attribute ... generates at most one final state, regardless of the ambiguity of the underlying grammar, the extended algorithm may generate several instances of this state, if the grammar is ambiguous Each instance...
- 4
- 266
- 0
from marx to lenin an evaluation of marx's responsibility for soviet authoritarianism
Ngày tải lên :
31/05/2014, 00:40
... interests This mass is thus already a class as against capital, but not yet for itself In the struggle this mass becomes united, and constitutes itself as a class for itself The interests it ... expression of antagonism in civil society.29 Marx 's socialism was state-less only in so far as the state was an expression of class society Marx did not share the anarchists' indiscriminate prejudice against ... first, sees Lenin as essentially a Marxist It is in this sense that the Eurocommunists maintained that Lenin, like themselves, was a 'revisionist' Radice, a leading Italian communist, has said that:...
- 263
- 290
- 0
Báo cáo hóa học: " Optimization of capsid-incorporated antigens for a novel adenovirus vaccine approach" doc
Ngày tải lên :
20/06/2014, 01:20
... motif- AAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEA NSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAA SGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ SNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQPEVEK ... GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ PEVEKPQKKP TEQGGGGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAA APAAQPEVEKPQKKPVIKPL Core Arg-Gly-Asp (RGD) motif italicized ... following pairs of primers: 33RGD sense (s) and 33RGD anti-sense (as), 43RGD sense (s) and 43RGD anti-sense (as), 53RGD sense (s) and 53RGD anti-sense (as), 63RGD sense (s) and 63RGD anti-sense (as),...
- 13
- 419
- 0
Báo cáo hóa học: " The equiconvergence of the eigenfunction expansion for a singular version of onedimensional Schrodinger operator with explosive factor" pptx
Ngày tải lên :
20/06/2014, 22:20
... lemma study this extension Lemma 1.1 The solutions o(x, l) and ψo(x, l) have the following asymptotic formulas 0≤x a cosh s( x − a) − cos sa sinh s( x − a) ; s ϕo (x, λ) = sin sx s ; − sin sa s ϕo ... λ) = − sinh s( π a) cos s( x − a ) cosh s( π a) sin s( x − a) ; s s sinh s( π −x) ; a < x ≤ π s a < x ≤ π 0≤x a (1:8) (1:9) Proof: The fundamental system of solutions of the equation -y″ = s2 y, (0 ... ⎪ sin sx + O e s2 ⎪ s | | ; 0≤x a ⎨ β(x) ϕ(x, λ) = s (a) sin sa cosh s( a − x) − cos sa sinh s( a − x) ⎪ ⎪ ⎩ +O e|Im s| a+ |Re s| (a x) , a < x ≤ π |s2 | (2:4) ⎧ α(x) ⎪ s α (a) [cos s( x − a) sinh s( π...
- 11
- 260
- 0
Báo cáo hóa học: " The equiconvergence of the eigenfunction expansion for a singular version of onedimensional Schrodinger operator with explosive factor" potx
Ngày tải lên :
20/06/2014, 22:20
... lemma study this extension Lemma 1.1 The solutions o(x, l) and ψo(x, l) have the following asymptotic formulas 0≤x a cosh s( x − a) − cos sa sinh s( x − a) ; s ϕo (x, λ) = sin sx s ; − sin sa s ϕo ... λ) = − sinh s( π a) cos s( x − a ) cosh s( π a) sin s( x − a) ; s s sinh s( π −x) ; a < x ≤ π s a < x ≤ π 0≤x a (1:8) (1:9) Proof: The fundamental system of solutions of the equation -y″ = s2 y, (0 ... ⎪ sin sx + O e s2 ⎪ s | | ; 0≤x a ⎨ β(x) ϕ(x, λ) = s (a) sin sa cosh s( a − x) − cos sa sinh s( a − x) ⎪ ⎪ ⎩ +O e|Im s| a+ |Re s| (a x) , a < x ≤ π |s2 | (2:4) ⎧ α(x) ⎪ s α (a) [cos s( x − a) sinh s( π...
- 11
- 268
- 0
Báo cáo hóa học: " Research Article From Newton’s Equation to Fractional Diffusion and Wave Equations" pptx
Ngày tải lên :
21/06/2014, 05:20
... calculus and the classical and quantum mechanics 44, 45 This is also the approach of the works of Rabei and coworkers 46 Fractional Calculus and Fractals Fractals and fractional calculus generate ... and are named viscoelastic materials The basic models of such materials are based on combinations of springs and dashpots 2, 16, 54 As an illustration, let us consider the combination of a spring ... Fractional Derivatives, Artishok-Press, Ulyanovsk, Russia, 2008 30 V Lakshmikantham, S Leela, and J Vasundhara-Devi, Theory of Fractional Dynamic Systems, Cambridge Scientific Publishers, Cambridge,...
- 13
- 313
- 0