method s should be used to infer genealogical relationships among intraspecific sequences
Population Genetics for Animal Conservation potx
... convictions of philosophers such as Emerson (1836), Muir (1916), and Naess (Naess 1973; Naess and Sessions ´ 1984), Soule also maintained that biological diversity has its own intrinsic j Heidi ... policy-makers need As should be obvious by its title, the purpose of this book is an attempt to go some way towards maturing such a synergy; hence, this introduction presents a brief history and ... are still in use today for screening many organisms, only a few biologists attempted to apply these methods to endangered species, since large tissue samples were rarely available for these taxa...
- 415
- 566
- 0
Tài liệu Báo cáo khoa học: Distribution of class I, III and IV alcohol dehydrogenase mRNAs in the adult rat, mouse and human brain ppt
... class exon ADH class exon 6–7 ADH class exon 6–7 ADH class exon ADH class exon ADH class exon ADH class exon ADH class exon ADH class exon ADH class exon ADH class exon ADH class exon ADH class ... lipofuscin pigments abundantly present in human brain tissue Results Expression of different ADH classes in tissues outside the CNS Figures and show results from specificity tests of all probes on ... oligonucleotides used in the present study may not have been sensitive enough to detect possible low expression levels of these enzyme classes Based on the Ó FEBS 2003 ADH expression patterns in mammalian...
- 11
- 603
- 0
Báo cáo khoa học: Characterization of the serotoninergic system in the C57BL/6 mouse skin potx
... metabolites of the indoleamine As NAS has been shown to be a substrate for horseradish peroxidase [46] it is possible that these metabolites could be the products of NAS oxidation by skin hemoproteins ... in spleen and pituitary deserves further study to assess the possible production of serotonin by these organs Our extensive molecular analyses of AANAT transcripts in the C57BL/6 mouse demonstrate ... dehydrogenase, 5; aldehyde reductase, Question marks represent products of NAS metabolism (for details see Discussion) to NAS would limit serotonin effects in the skin (proedema, vasodilatory, pruritogenic...
- 10
- 409
- 0
báo cáo hóa học: " Reduced inflammation accompanies diminished myelin damage and repair in the NG2 null mouse spinal cord" potx
... various analyses, images were processed with Adobe Photoshop CS3 Ver 10.0 (Adobe Systems) to standardize brightness and contrast All data were analyzed statistically using ANOVA and un-paired t-tests ... axons inside the lesion site, some BrdU-positive macrophages/microglial cells were also seen outside the lesion (Figure 5) For these studies we used the IBA-1 marker because of its expression ... mm segments were dissected, spanning from mm above to mm below the lysolecithin injection site Dissected spinal cord segments were immersed for 30 seconds in isopentane on dry ice and then stored...
- 13
- 480
- 0
báo cáo hóa học:" Progressive obesity leads to altered ovarian gene expression in the Lethal Yellow mouse: a microarray study" pptx
... sequences Biotinylated cRNA probes were synthesized from the extracted RNA samples per supplier 's directions as previously described [19] using CodeLink Expression Assay Reagent Kit (GE-Amersham Biosciences) ... involved in steroid synthesis and metabolism Notably, obesity was associated with a regulatory shift in ovarian glucocorticoid metabolism These results suggest that obesity impacts reproductive ... control and/or extraovarian factors arising from obesity The present study was designed to test the hypothesis that progressive obesity in LY mice alters ovarian gene expression independently of altered...
- 9
- 346
- 0
Báo cáo y học: "Hepatocyte growth factor ameliorates dermal sclerosis in the tight-skin mouse model of scleroderma" doc
... HGF fibrosis in TSK/+ mice Representative histologic sections stained with hematoxylin and eosin are shown (× 40) An asterisk indicates the subcutaneous loose connective tissue layer beneath the ... allogeneic HSCT recipients reduced the tissue damage and subsequent inflammatory responses caused by acute GVHD [15,16] To investigate the possible therapeutic effects of HGF on SSc, young TSK/+ mice ... with exogenous HGF is necessary to accelerate the tissue repair process in animal models [14,15,28] In the present study, we assessed the effect of exogenous HGF on skin fibrosis and the development...
- 7
- 399
- 0
Báo cáo y học: "Analysis of C4 and the C4 binding protein in the MRL/lpr mouse" pptx
... FAS gene, results in loss of FAS function and thus a defect in FAS-mediated apoptosis [33] When present on the MRL genetic background, the loss of FAS-mediated apoptosis results in massive lymphoproliferation ... (hemolytic test )−OD412 (negative control) × 100 Percentage lysis = OD412 (100% lysis)−OD412 (spontaneous lysis) C57BL/6 serum was used as a positive control Statistics The figures show the means, with ... rheumatic fever, systemic lupus ervthematosus, and rheumatoid arthritis Lab Invest 1957, 6:205-217 Schur PH, Sandson J: Immunologic factors and clinical activity in systemic lupus erythematosus N Engl...
- 10
- 457
- 0
báo cáo khoa học: " Increased hepatic oxidative metabolism distinguishes the action of Peroxisome proliferator-activated receptor d from Peroxisome proliferatoractivated receptor g in the ob/ob mouse" ppt
... used as substrates in gluconeogenesis An alternative fate for the amino acids is as substrates for the TCA cycle, which was also affected The increased demand for TCA cycle substrates was also ... across the different tissues, as well as potential cross-talk between the three different PPARs Thus, while synthesis of polyunsaturated fatty acids may be increased by PPARδ stimulation, increased ... this supervised analysis, the majority of the Q2 values (testing model statistical robustness) were low, despite the δ and γ agonist treatment groups separating along the same scores plot axis...
- 12
- 266
- 0
Báo cáo y học: "Quantifying the major mechanisms of recent gene duplications in the human and mouse genomes: a novel strategy to estimate gene duplication rates" docx
... families However, because the species used in their study and ours are different, more work should be done to test this hypothesis The comparison of different mechanisms enables us to gain more insight ... increases from to about 0.05 to 0.1 This could be caused by either an excess of young TAGs caused by gene conversion or by a lack of retrogenes in small Ks bins refereed research We used Ks as a ... gene pairs in human and 108 pairs in mouse We computed Ka (the number of nonsynonymous substitutions per nonsynonymous site) and Ks (the number of synonymous substitutions per synonymous site) for...
- 11
- 357
- 0
Báo cáo y học: " Gene expression regulation in the context of mouse interspecific mosaic genomes" pdf
... genome harbors segments from various subspecies (M musculus domesticus, M musculus molossinus, M musculus musculus) [1,3] In the present study, we used an original mouse model to explore genome-wide ... segments in the IRCSs, approximately 95% of the transcripts showed a M musculus-like expression level (belonging to classes and 1) For such genes of class 0, the minimal hypothesis is a satisfactory ... from the analysis, no specific correlation persists between SEG and the IRCSs This suggests that the same set of genes drives normal testis function in B6, SEG and the IRCSs Then, considering only...
- 18
- 460
- 0
Role of SPHK2S1P signalling in regulating mitochondrial function in the MPTP induced mouse model of parkinsons disease and in the MPP treated MN9D cells
... mean SM sphingomyelin SNc substantia nigra pars compacta SNCA synuclein alpha SNP single nucleotide polymorphism SOD superoxide dismutase SPP1 sphingosine-1-phosphate phosphatase SPP2 sphingosine-1-phosphate ... undiagnosed and as many as 25% are diagnosed wrongly (Tolosa et al., 2006) This is due to the fact that as the disease progresses, the symptoms may imitate other disorders Besides, currently there is ... over 65 years suffer from PD This estimate increases to % to % in people 85 years and older (Fahn, 2003) In some rare cases, PD-like symptoms has been observed in youngsters Since PD is still regularly...
- 178
- 359
- 0
Tài liệu Báo cáo khoa học: Treatment of neutral glycosphingolipid lysosomal storage diseases via inhibition of the ABC drug transporter, MDR1 Cyclosporin A can lower serum and liver globotriaosyl ceramide levels in the Fabry mouse model doc
... neutral GSL synthesis in neutral GSL storage diseases Other substrate reduction approaches are less selective and hence have greater potential sideeffects Inhibitors of glucosyl ceramide synthase prevent ... biosynthesis in vivo was by no means assured The possibility of using MDR1 inhibition as a new approach to neutral GSL storage diseases is supported by our finding that CsA completely reverses GSL accumulation ... normal mouse but this was not obviously affected by the current CsA protocol However, because these tissues are less sensitive than liver to ERT [9], the potential benefit of CsA in these tissues might...
- 12
- 432
- 0
Tài liệu Báo cáo khoa học: Characterization of the promoter for the mouse a3 integrin gene Involvement of the Ets-family of transcription factors in the promoter activity doc
... TATA-less gene promoters initiates at a consensus sequence designated as the initiator sequence [36] The sequences surrounding the two transcription start sites of the mouse integrin a3 subunit ... constructed in pGL3-basic Transfection and luciferase assay Luciferase assay was conducted using a Luciferase Assay System (Promega) along with reporter plasmids constructed in pGL3-basic plasmid ... mobility shift assay (EMSA) using the Ets consensus site at )133 As the involvement of the Ets consensus binding site at )133 in the promoter activity of the mouse a3 integrin gene was suggested...
- 9
- 562
- 0
Báo cáo khoa học: Investigating the role of the invariant carboxylate residues E552 and E1197 in the catalytic activity of Abcb1a (mouse Mdr3) docx
... active site, progression into the transition state induces asymmetry in the nucleotide-binding sites such that NBD2 is committed to hydrolysis Analyzing the results of this and other studies, it seems ... strain GS115, according to the manufacturer s instructions (Invitrogen, Carlsbad, CA, USA; license number 145457) and screened for expression as previously described [35] Glycerol stocks of P pastoris ... drug stimulation can be observed, suggesting that signal transduction between the drug binding site (s) and the NBDs is not affected by the mutations Studies on the single-site mutants Our results...
- 13
- 458
- 0
Báo cáo khoa học: Structural and functional consequences of single amino acid substitutions in the pyrimidine base binding pocket of Escherichia coli CMP kinase pdf
... 1.56 dCMP S3 6 a Numbers in parentheses represent values in the highest resolution shell (last of 20 shells) b Rsym ẳ ShSi |I(h,i) ) < I(h) > | ShSi I(h,i) where I(h,i) is the intensity value ... least-squares tting analysis of KALEIDAGRAPH software Km is the MichaelisMenten constant; kcat was calculated assuming a molecular mass of E coli CMP kinase of 24.7 kDa Values are means of two to ... kinase shows that D132 contributes to the stability by )37.7 kJ Thus, replacing this residue with Ser, Ala or His should have a signicant effect on stability, depending on the substituting residue...
- 11
- 437
- 0
Báo cáo khoa học: Secondary structure assignment of mouse SOCS3 by NMR defines the domain boundaries and identifies an unstructured insertion in the SH2 domain pdf
... characterization of SOCS3 N-terminal SH2 SOCS box P 45 185 socs1 socs2 socs4 socs5 socs6 socs7 P P socs3 225 P P P CIS Fig The suppressor of cytokine signalling (SOCS) family of proteins The eight members of ... SOCS5 SOCS6 SOCS7 CIS PESTfind score Sequence Location 14.2 NA 11.1 NA 7.4 11.3 NA 11.9 9.0 22 RSEPSSSSSSSSPAAPVR 39 NA 126 HYMPPPGTPSFSLPPTEPSSEVPEQPPAQALPGSTPK 162 NA 96 KDSDSGATPGTR 107 243 HSTFFDTFDPSLVSTEDEEDR ... promoters Rapid destruction of the SOCS protein is also necessary, once signalling has ceased, to allow for subsequent cytokine stimulation The level of SOCS1 and SOCS3 protein in vivo appears to be...
- 11
- 525
- 0
Báo cáo khoa học: New members of the brachyurins family in lobster include a trypsin-like enzyme with amino acid substitutions in the substrate-binding pocket potx
... catalytic Asp of serine proteases has been reported to be DISLL in L vannamei [10] and was less conserved in lobster (DISVL) Among the three active site motifs, this is the least conserved in serine ... argus trypsin-like sequences have four more conserved Cys residues (Cys71, Cys157, Cys224, Cys252) than crayfish trypsin and, therefore, additional disulfide bonds could be established According to ... trypsin are represented in Fig 3D However, in terms of amino acid sequences, the 3494 surface Loop1 has been shown to be similar among trypsin variants within species like the flat fish Solea senegalensis...
- 13
- 474
- 0
Báo cáo khoa học: The relative contribution of mannose salvage pathways to glycosylation in PMI-deficient mouse embryonic fibroblast cells pdf
... concentrations of mannose The glycosylation analysis was then performed as described above GFP–SKD1E235Q overexpression A Cre ⁄ loxP inducible system was utilized to express SKD1E235Q [26], because constitutive ... adenovirus expression system of mutant DNase I was constructed as follows Adenoviruses bearing mutant bovine DNase I was prepared using the ViraPower Adenovirus Expression System according to the manufacturer s ... pathways This allowed us examine the mannose salvage pathways at physiological concentrations of glucose We consider that the glycosylation analysis method using DNase I works well because N-glycosylation...
- 11
- 428
- 0
Báo cáo khoa học: Identification of an antibacterial protein as L-amino acid oxidase in the skin mucus of rockfish Sebastes schlegeli pot
... both SSAP and AIP have strict specificity with respect to the substrate, catalyzing the oxidation of only l-Lys These results suggest structural similarity between their substrate-binding sites SSAP ... protein, P damselae ssp piscicida was used because of its high sensitivity to SSAP [22] Briefly, a mixture of 50 lL sample solution and 50 lL bacterial suspension (1 · 105 colony-forming unitsÆmL)1), ... aminoacid sequence of SSAP to LAOs Amino-acid sequence alignment analysis using clustalw (version 1.83) revealed that SSAP shows a weak homology to antibacterial LAOs, such as aplysianin A (11%),...
- 12
- 470
- 0
Báo cáo khoa học: Dual expression of mouse and rat VRL-1 in the dorsal root ganglion derived cell line F-11 and biochemical analysis of VRL-1 after heterologous expression pptx
... properties of single neurons Four cell lines (F-11 A–D) showed properties characteristic of DRG neurons, such as action potentials, extensive neurite-like processes and expression of neuronal gangliosides ... B (PB), mannose phosphate isomerase (MPI)] were shown to be expressed in all four stable F-11 cell lines A–D Unique expression of mouse PB and MPI was observed in line C [7] As shown by Mevel-Ninio ... features of DRG cells present in F-11 cells such as l- and d-opioid receptors, receptors for prostaglandin and bradykinin, and voltage-sensitive calcium channels Also F-11 cells synthesize and...
- 8
- 439
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25