matlab as a design and verification tool for the hardware prototyping ofwireless communication s

Evaluation of Dredged Sediment as a Silt and Clay Source for Artificial Tidal Flats

Evaluation of Dredged Sediment as a Silt and Clay Source for Artificial Tidal Flats

Ngày tải lên : 05/09/2013, 09:38
... polychaetes and bivalves was consistent in the artificial and natural tidal flats These results indicate that DS can be used as an additive to the sandy medium for construction of artificial tidal ... nutrients for improving the tidal flat ecosystem An essential task is to investigate how DS addition to the sandy media affects the emerging tidal flat ecosystems This research was carried out to assess ... assess the feasibility of using DS as the additive for construction of artificial tidal flats Artificial tidal flats were constructed in a tidal flat simulator and at the real seashore using...
  • 13
  • 586
  • 0
báo cáo khoa học: "Use of RE-AIM to develop a multi-media facilitation tool for the patient-centered medical home" potx

báo cáo khoa học: "Use of RE-AIM to develop a multi-media facilitation tool for the patient-centered medical home" potx

Ngày tải lên : 10/08/2014, 11:20
... delivering summary self-management support reports, and providing recommendations for patients and healthcare teams The assessment module uses brief evidence-based screening scales to assess behaviors ... providers in the assessment, monitoring, and management of a variety of health behaviors, psychosocial concerns, and chronic disease problems The automated, web-based system uses engaging graphics, ... cessation, alcohol use, and depression/distress These interactive modules facilitate patient selection of goals in any of these areas, and identification of benefits, barriers to success, and strategies...
  • 31
  • 351
  • 0
Báo cáo y học: "Anni 2.0: a multipurpose text-mining tool for the life sciences" ppt

Báo cáo y học: "Anni 2.0: a multipurpose text-mining tool for the life sciences" ppt

Ngày tải lên : 14/08/2014, 08:21
... - for example, "cutaneous leishmaniasis", "leishmaniasis" and "visceral leishmaniasis" were mapped to "leishmaniasis"; and animal diseases were removed, for example, "toxoplasmosis, animal" The ... pathways responsible for the progression of prostate cancer to metastatic disease The dataset was generated based on three published studies [30-32] Data from these studies were processed as in the ... discovery The tool has several innovative and useful features as described below Anni uses a concept-based approach Definitions for the concepts are available in the application, as well as links...
  • 10
  • 336
  • 0
Ethical Banking And Finance: A Theoretical And Empirical Framework For The Cross-Country And Inter-Bank Analyis Of Efficiency, Productivity, And Financial Performance

Ethical Banking And Finance: A Theoretical And Empirical Framework For The Cross-Country And Inter-Bank Analyis Of Efficiency, Productivity, And Financial Performance

Ngày tải lên : 10/12/2016, 22:57
... total assets Personal expenses = total amount of wages and salaries / total assets Liquid assets / total deposits and short term funding The logarithm of total assets as a proxy of a banks size ... profit sharing basis rather than the mark up basis is used, the banks have no alternative but to determine a profit that would assure that the banks profit is almost the same as the interest on the ... productive and surplus assets that have been possessed for a full year This means that casual acquisitions and perishable goods are not subject to Zakah (Clarke, Craig, and Hamid, 1996) More specifically,...
  • 216
  • 429
  • 0
báo cáo khoa học: " NorthStar, a support tool for the design and evaluation of quality improvement interventions in healthcare" ppt

báo cáo khoa học: " NorthStar, a support tool for the design and evaluation of quality improvement interventions in healthcare" ppt

Ngày tải lên : 11/08/2014, 05:22
... Resources) Table shows the general outline of each of these sections NorthStar software NorthStar is available as an HTML Help system, or as a browser-based version Figure shows a sample screenshot ... NorthStar is available as both a browser-based version and an HTML help file version, and will soon be available in French and Italian, as well as English While the focus of NorthStar is on QI ... in changing practice patterns; they are usually categorized as "barriers and facilitators" or as "moderators and mediators" [7,8] The NorthStar section on cluster RCTs is based, in part, on the...
  • 7
  • 429
  • 0
A Study on the Effects of Argentine Tango as a Form of Partnered Dance for those with Parkinson Disease and the Healthy Elderly pptx

A Study on the Effects of Argentine Tango as a Form of Partnered Dance for those with Parkinson Disease and the Healthy Elderly pptx

Ngày tải lên : 28/03/2014, 20:20
... while assisting the dancers with individual questions Sometimes as many as four and never less than two assistant instructors would dance with the students and answer questions Traditional tango ... c Shrug: Arms behind chair with wand d Arm extension: press the wand backwards (arms still behind chair) e Finger roll: As fast as you can, then as slow as you can; Rolling out to the sides of ... warm-up, the class typically began holding hands in a circle Imagery was suggested to the participants, such as ‘‘clouds beneath their Dance for those with Parkinson Disease 115 arms’’ so they could...
  • 19
  • 648
  • 0
báo cáo hóa học: " Video capture virtual reality as a flexible and effective rehabilitation tool" pot

báo cáo hóa học: " Video capture virtual reality as a flexible and effective rehabilitation tool" pot

Ngày tải lên : 19/06/2014, 10:20
... assessment and treatment intervention [7] The list of applications is long and diverse, and only several examples are provided here VR has been used as a medium for the assessment and rehabilitation ... with the ability to further adapt existing applications such as the standard set of games [33] and to design and implement novel applications such as the virtual mall described above [45] The ... meaning to the virtual experience as well as the actual performance of virtual tasks or activities occurs The sense of presence enables the client to focus on the virtual task, separating himself...
  • 12
  • 412
  • 0
Báo cáo hóa học: "IDEA1: A validated SystemC-based system-level design and simulation environment for wireless sensor networks" pot

Báo cáo hóa học: "IDEA1: A validated SystemC-based system-level design and simulation environment for wireless sensor networks" pot

Ngày tải lên : 20/06/2014, 22:20
... channel access failures and causes lower PDR too The best PDR, hence, occurs in the case with a moderate payload However, payload should be as short as possible A smaller payload means the first ... last sensor data will be sent and the first one will be discarded The duration for the last sensor data stayed in the buffer is smaller; therefore, AL decreases The ECPkts remain constant for the ... channel usages with other nodes, these transmissions are longer than the cases with a smaller sample rate and AL will increase compared with the lightly loaded stage The smallest energy consumption...
  • 20
  • 408
  • 0
báo cáo khoa học: " The Rx for Change database: a first-in-class tool for optimal prescribing and medicines use" ppt

báo cáo khoa học: " The Rx for Change database: a first-in-class tool for optimal prescribing and medicines use" ppt

Ngày tải lên : 10/08/2014, 10:23
... consistent summary format for each review and ensures the accuracy of the information Analysis and synthesis We analyse, summarise, and report separately the results of all relevant comparisons ... databases, including MEDLINE, EMBASE, Database of Abstracts of Reviews of Effects (DARE), and the Cochrane Database of Systematic Reviews (CDSR) In addition, we systematically hand-search the CDSR and ... content and the significance of the database for healthcare policy makers, researchers, professionals, and consumers Methods Design and procedure Our goal for the Rx for Change database is to provide...
  • 9
  • 245
  • 0
báo cáo khoa học: " Evaluation of a clinical decision support tool for osteoporosis disease management: protocol for an interrupted time series design" ppt

báo cáo khoa học: " Evaluation of a clinical decision support tool for osteoporosis disease management: protocol for an interrupted time series design" ppt

Ngày tải lên : 10/08/2014, 11:20
... benefit may include an increased awareness for patients about osteoporosis and its associated risks, the availability of relevant information about what they can about these risks, and the opportunity ... treatment effects and secular trends The advantage of using the ARIMA approach for analysis is that it accounts for the three major sources of noise that may confound the analysis: trend, seasonality, ... This is expected to increase the prevalence of chronic diseases [40] and increase the awareness and the need for patient self-care to support chronic disease management [40,41] As a result, there...
  • 7
  • 436
  • 0
Báo cáo y học: " Development and evaluation of a tool for the assessment of footwear characteristics" pdf

Báo cáo y học: " Development and evaluation of a tool for the assessment of footwear characteristics" pdf

Ngày tải lên : 10/08/2014, 21:23
... Intra-rater reliability Intra-rater ICCs and 95% LOAs for quantitative measures are shown in Table Similar intra-rater reliability was found for both raters across all measures Most quantitative ... and the absence of pressure on the dorsal aspect of the toes and nails was considered to categorise depth as adequate or too shallow [17] Item General features Age of shoe The age of the shoe is ... reliability evaluation for the items contained within them Menz and Sherrington [20] developed the seven item Footwear Assessment Form as a simple clinical tool to assess footwear characteristics related...
  • 12
  • 379
  • 0
Báo cáo y học: " Exploring mentorship as a strategy to build capacity for knowledge translation research and practice: protocol for a qualitative study" pps

Báo cáo y học: " Exploring mentorship as a strategy to build capacity for knowledge translation research and practice: protocol for a qualitative study" pps

Ngày tải lên : 11/08/2014, 05:21
... professional advancement and research success among health professional faculty SES conducted a systematic review to assess the evidence about the use and outcomes of academic mentorship in health ... organizations in Canada and elsewhere to develop, implement, and evaluate mentorship for KT research and practice This research will establish a theoretical basis upon which we and others can ... quantitative (metaanalyses, questionnaire surveys, observational studies, randomized trials) and qualitative (reviews/conceptual analyses, interviews, focus groups) studies published in English...
  • 8
  • 592
  • 0
báo cáo khoa học: " Whole-Organ analysis of calcium behaviour in the developing pistil of olive (Olea europaea L.) as a tool for the determination of key events in sexual plant " ppsx

báo cáo khoa học: " Whole-Organ analysis of calcium behaviour in the developing pistil of olive (Olea europaea L.) as a tool for the determination of key events in sexual plant " ppsx

Ngày tải lên : 11/08/2014, 11:21
... flower anthesis (from stage to stage 4), the Ca 2+ pool increased progressively and reached the maximal values just after anther dehiscence (stage 4) At the latest analyzed stage (stage 5) a significant ... showed the accumulation of Ca/Sb precipitates in the vacuoles of the stigma cells as well as in the intracellular spaces between them The stigmatic surface is the main place for signal exchange between ... In the style of the pistil at stage 4, the most intense labelling was located along the transmitting tissue, whereas the remaining stylar tissues showed relatively low staining (Figure 6A and...
  • 12
  • 529
  • 0
báo cáo khoa học: " Exploring mentorship as a strategy to build capacity for knowledge translation research and practice: protocol for a qualitative study" pot

báo cáo khoa học: " Exploring mentorship as a strategy to build capacity for knowledge translation research and practice: protocol for a qualitative study" pot

Ngày tải lên : 11/08/2014, 16:20
... professional advancement and research success among health professional faculty SES conducted a systematic review to assess the evidence about the use and outcomes of academic mentorship in health ... organizations in Canada and elsewhere to develop, implement, and evaluate mentorship for KT research and practice This research will establish a theoretical basis upon which we and others can ... quantitative (metaanalyses, questionnaire surveys, observational studies, randomized trials) and qualitative (reviews/conceptual analyses, interviews, focus groups) studies published in English...
  • 8
  • 317
  • 0
Báo cáo y học: "Assessing the psychometric properties and the perceived usefulness of the BasisRaadsOnderzoek (BARO) as a first-line screening instrument for juvenile offenders" ppt

Báo cáo y học: "Assessing the psychometric properties and the perceived usefulness of the BasisRaadsOnderzoek (BARO) as a first-line screening instrument for juvenile offenders" ppt

Ngày tải lên : 13/08/2014, 18:22
... instrument was calculated for the participants that underwent the global screening by means of the BARO as well as the elaborate forensic diagnostic assessment The concurrent validity was based on the ... version The instrument was also translated into English, German, Russian and Finnish It is being used in Switzerland, Austria and Finland The German-language version was validated in Switzerland ... contributions TD was responsible for the research project EvL carried out the statistical analyses RV was co writer of the paper and performed the ROC analyses CB was co writer and performed all editorial...
  • 7
  • 382
  • 0
Báo cáo y học: "yrGATE: a web-based gene-structure annotation tool for the identification and dissemination of eukaryotic genes" pdf

Báo cáo y học: "yrGATE: a web-based gene-structure annotation tool for the identification and dissemination of eukaryotic genes" pdf

Ngày tải lên : 14/08/2014, 16:21
... ATGTGCATTTGTAGAAGTTTGGTCATCTAGCAGAACAGAAAATTA CTCAAAAGCCTTTGAGCAGCAACTTCTTGATATGGGAGCAAAAGT TTCAAAAACTTTCAACAAGCGCGTGACACATGTAGTCTTCAAAGA TGGACATTCAACTACATGGAGAAAAGCACAGGATGCTGGTGTAAA blastn blastx tblastx Protein Coding Region Start ... amino acids) MTPPGQLLPLSRLPPGLSSRCPPPAHAQARVSLLHPWAHRLHGRF MPSPHLFRSPACPPRAPTPPGLSAAAGGEAQAAAVAEFVTSERVK VAAMLGLALALCNADRVVMSVAIVPLSQAYGWTPSFAGVVQSSFL WGYLMSPIIGGALVDYYGGKRVMAYGVALWSLATFLSPWAAGRSI ... 19824860 957488 ACTCGAGGATGACACTTCGGCCGATGAGGTACAAGTTTCTTCTATTTGTTTTGGAATAAAGTGTAATCGCCGTGCTTAATGATTTTCCCACAATCGATCAGCAGGATAAGGAGATTGATCTGCCAGAGTCCATT ACTCGAGGATGACACTTCGGCCGATGAG>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>CAGGATAAGGAGATTGATCTGCCAGAGTCC...
  • 11
  • 467
  • 0
Identification of plant as a novel and alternative host model for burkholderia pseudomallei

Identification of plant as a novel and alternative host model for burkholderia pseudomallei

Ngày tải lên : 09/10/2015, 10:49
... if any, of BpTTSSs and BtTTSSs in plant pathogenesis can be determined using B pseudomallei and B thailandensis as models 2.2 Materials and Methods 2.2.1 PCR primers, plasmids and bacteria strains ... infectious dust particles In humans, the disease could present with varied manifestations ranging from asymptomatic infection, localized disease such as pneumonia or organ abscesses to systemic disease ... Melioidosis the disease Burkholderia pseudomallei is the causative agent of melioidosis, an infectious disease endemic in South East Asia and the northern part of Australia with significant morbidity...
  • 119
  • 420
  • 0
Euro English A Debate and its Implications for Teaching English as a Foreign Language

Euro English A Debate and its Implications for Teaching English as a Foreign Language

Ngày tải lên : 26/03/2016, 13:47
... answered a questionnaire consisting of two parts Part one investigates the background of the teachers, their attitudes towards different varieties of English, and their awareness of the research regarding ... continental Europe, also known as Euro-English Their research has surfaced multiple features that are unique to European speakers of English Twenty-one teachers participated in a survey They answered ... Euro-English Part two tests the acceptability of ten features that have been claimed to be specific for mainland Europeans Results of this study reveal that there is little awareness of non-native varieties...
  • 6
  • 503
  • 0
Optimization of design and operating parameters on the year round performance of a multi-stage evacuated solar desalination system using transient mathematical analysis

Optimization of design and operating parameters on the year round performance of a multi-stage evacuated solar desalination system using transient mathematical analysis

Ngày tải lên : 05/09/2013, 16:11
... multi-stage desalination system consists of Ns number of such stages stacked one over the other The condenser surface of bottom stages acts as the evaporator surface for the stages above The system ... the water in the basin and inner surface glass cover In a passive solar still, the solar radiation is received directly by the basin water and is the only source of energy for raising the water ... various design and operating parameters on the performance and thermal characteristics of the system Description of the multi-stage evacuated solar desalination system The Multi-stage evacuated solar...
  • 26
  • 568
  • 0