iappli micro java with a twist
Tài liệu Micro Java™ Game Development pdf
... information about JavaCard can be found at http:/ /java. sun.com/products/javacard/ EmbeddedJava Sun's EmbeddedJava technology is a way of taking a standard Java application environment and condensing ... comes packaged with the Kada APIs, which support PersonalJava 1.1.8 as well as java. sql and java. math for more advanced applications The Kada APIs have a total footprint of 460KB There are two ... of games can be designed that take advantage of new lifestyles Enter Micro Java The Java language, created by Sun Microsystems, is another example of a paradigm shift As a language that had no...
- 418
- 8,013
- 0
Five stories that are almost true, but not quite
... black coat over that All with an impeccable fit What made me unable to take my eyes off her was the fantastic way she was made up “You are a modern-day Cleopatra!” “Thank you It's my Moni He made ... the easy way out, that was certain, but as I walked slowly adding and subtracting the pros and cons, I did not manage to reach a conclusion Later, when I returned home, I found Anna and my grandmother ... the last time, will you please leave Michael alone and stop being so indiscreet, Anna.” Granny was exasperated and mother smiled She was probably not averse to hearing a few details herself With...
- 11
- 460
- 0
Báo cáo y học: "Peripheral blood but not synovial fluid natural killer T cells are biased towards a Th1-like phenotype in rheumatoid arthritis" pptx
... mammalian evolution J Exp Med 1998, 188:1521-1528 Nieda M, Nicol A, Koezuka Y, Kikuchi A, Takahashi T, Nakamura H, Furukawa H, Yabe T, Ishikawa Y, Tadokoro K, et al.: Activation of human Valpha24NKT ... 2001, 194:1789-1799 Furlan R, Bergami A, Cantarella D, Brambilla E, Taniguchi M, Dellabona P, Casorati G, Martino G: Activation of invariant NKT cells by alphaGalCer administration protects mice ... subsequently harvested using an automated cell harvester (Pharmacia, Uppsala, Sweden) Incorporated radioactivity was measured using a β-plate liquid scintillation counter (Wallac, Turku, Finland) A NKT...
- 10
- 352
- 0
Báo cáo y học: "Genetic polymorphism of p53, but not GSTP1, is association with susceptibility to esophageal cancer risk – A Meta-Analysis"
... Asian Morita S[29] 1998 Japan Asian van Lieshout EM[30] 1999 The Netherlands Caucasian Tan W&[31] 2000 China Asian Lee JM[22] 2000 China(Taiwan) Asian Casson AG[21] 2003 Canada Caucasian Roth MJ[32] ... MJ[32] 2004 China Asian Casson AG[20] 2006 Canada Caucasian Cai L[25] 2006 China Asian Murphy SJ[33] 2007 Irish Caucasian Canova C[19] 2009 European Caucasian SNP site Sample size HWE MAF Genotypic ... esophageal cancer histologically, squamous cell carcinoma (SCC) and adenocarcinoma, and each has distinct etiologic and pathologic characteristics Squamous cell is cancer located in epithelial...
- 9
- 615
- 0
Báo cáo y học: "TPO, but not soluble-IL-6 receptor, levels increase after anagrelide treatment of thrombocythemia in chronic myeloproliferative disorders"
... 2000;36:533-8 Tomita N, Motomura S, Sakai R, Fujimaki K, Tanabe J, Fukawa H, Harano H, Kanamori H, Ogawa K, Mohri H, Maruta A, Kodama F, Ishigatsubo Y, Tahara T, Kato T Strong inverse correlation between ... myelodysplastic syndrome with myelofibrosis Leukemia 2005;19:1558-66 Hirayama Y, Sakamaki S, Matsunaga T, Kuga T, Kuroda H, Kusakabe T, Sasaki K, Fujikawa K, Kato J, Kogawa K, Koyama R, Niitsu ... T, Kuroda H, Takimoto R, Takayama T, Kato J, Yamauchi N, Kogawa K, Sakamaki S, Hirayama Y, Kohda K, Niitsu Y Involvement of transforming growth factor-beta and thrombopoietin in the pathogenesis...
- 5
- 498
- 0
Tài liệu Báo cáo khoa học:Tyrosine phosphorylation of tau regulates its interactions with Fyn SH2 domains, but not SH3 domains, altering the cellular localization of tau ppt
... findings that pervanadate treatment increased the association of wild-type tau with GST–Fyn-SH2 In addition, although a 64-kDa YallF tau band was apparent in lysates from cells cotransfected with the ... increased amount of tau bound to Fyn-SH2, as compared with cells treated with catalase (Fig 1A) Furthermore, a tau species of 68 kDa was apparent in SH2 pulldowns from pervanadate-treated cells ... Briefly, vanadate stock solution was prepared as a 200 mM solution of sodium orthovanadate (pH 10) Pervanadate was prepared as a ·100 stock by adding 50 lL of 200 mM sodium orthovanadate and 1.6...
- 11
- 628
- 0
Tài liệu Báo cáo khoa học: Dual P2Y12 receptor signaling in thrombin-stimulated platelets – involvement of phosphoinositide 3-kinase b but not c isoform in Ca2+ mobilization and procoagulant activity pdf
... phosphatase activity Measurement of Akt activation Akt activation was measured by western blot analysis, using a phosphoserine-473 Akt polyclonal antibody (Biosource International, Camarillo, CA, ... supplementary material is available online: Fig S1 Proposed role of the P2Y12 receptor in regulating Ca2+ signaling and platelet procoagulant activity This material is available as part of the online article ... phospholipase C activity The PI3-K pathway might enhance Ca2+ mobilization by reducing Ca2+ removal via sarco- and endoplasmic reticulum Ca2+-ATPase (SERCA) inhibition, in a similar way to that proposed...
- 15
- 565
- 0
Tài liệu Báo cáo khoa học: Activated Rac1, but not the tumorigenic variant Rac1b, is ubiquitinated on Lys 147 through a JNK-regulated process docx
... ubiquitination is unlikely to be related to a defective membrane interaction While being persistently activated and associated with plasma membrane, Rac1b has an impaired ability to activate several ... bona fide active state, Rac1L61R147 was largely associated with plasma membrane in HEK293 cells (supplementary Fig S2) and was found to activate JNK to the same extent as Rac1L61 (data not shown); ... of activated Rac1 with plasma membrane results in abolition of Rac1L61 ubiquitination [35]; using the nonisoprenylable-activated Rac1L61G189 mutant, we confirmed that plasma membrane localization...
- 11
- 469
- 0
Cytoskeleton reorganization mediates alpha beta integrin-associated actions of laminin on proliferation and survival, but not on steroidogenesis of ovine granulosa cells pdf
... ovulation From the primordial to the preovulatory follicular stage, the outer layer of granulosa cells (GC) lays on a basal lamina that separates them from the theca layers and interstitial ovarian ... (approval number A 37801) and conducted in accordance with the guidelines for Care and Use of Agricultural Animals in Agricultural Research and Teaching Experimental research was performed with ... experiments, participated in actin staining experiments, statistical analysis and interpretation of data, and participated in drafting the manuscript SF participated in steroid assays and contributed...
- 17
- 521
- 0
Blackwell Science, Ltd Group breeding dramatically increases reproductive success of yearling but not older female scrubwrens: a model for cooperatively breeding birds? ppt
... occupy an area of 40 ha, of which 27 are planted with native Australian plants Most of the remainder is natural woodland, which is contiguous with the woodland of Canberra Nature Park The birds are ... Whittingham 1997) Males in a group form a dominance hierarchy, with older males being more dominant Groups larger than pairs generally form through natal philopatry of males, although occasionally males ... compared with older females, using data gathered over years Given that group size may covary with territory quality and breeder quality (above), these potentially confounding variables are also examined...
- 16
- 337
- 0
Dangerous But Not Omnipotent pptx
... Arab fears of Shi’ite ascendancy and sectarian strife in their media outlets to curry favor for what is essentially a classic balance-of-power strategy against Iran Regarding a U.S attack against ... Iran was not allowed to play a constructive role in either 14 Kayhan Barzegar, “Tazad-e Naghshha: Baresiye rishehaye monazeeye Iran va Amrica bad az havadese 11 September [Conflicting Role: A ... Minister ‘Ali Shamkhani is an ethnic Arab (on several occasions, he was dispatched by the Khatami administration to Khuzestan to allay Arab fears of marginalization), and the Supreme Leader himself...
- 233
- 229
- 0
Báo cáo khoa học: Protein crystallography for non-crystallographers, or how to get the best (but not more) from published macromolecular structures potx
... problems may be encountered in individual cases We B Fig Two examples of a Ramachandran diagram (A) Plot for Erwinia chrysanthemi L-asparaginase, one of the largest structures solved to ˚ date at atomic ... 333–346 ´ 72 Bujacz G, Jaskolski M, Alexandratos J, Wlodawer A, Merkel G, Katz RA & Skalka AM (1996) The catalytic domain of avian sarcoma virus integrase: conformation of the active-site residues ... based on calculations that data are not easy to fake Perhaps the best known case of that sort was a discovery that the published diffraction patterns attributed to valyl tRNA were actually those...
- 21
- 570
- 0
Báo cáo khoa học: H2O2, but not menadione, provokes a decrease in the ATP and an increase in the inosine levels in Saccharomyces cerevisiae An experimental and theoretical approach pot
... essentially the same in both cases and, above all, no appreciable differences in the rates of disappearance of ATP or appearance of Ino were observed Theoretical approach mathematical simulation ... towards inosine, and that the adenylic charge value decreases, from a standard value of around 0.8 to a value of around 0.4 Similar results to those obtained with galactose, concerning variations ... the above values, application of the MATHEMATICA-3.0 program [37] to the case of a reaction mixture containing ATP, ADP and AMP (at the same concentrations as those present in the experimental approach,...
- 12
- 506
- 0
Báo cáo Y học: Ruk is ubiquitinated but not degraded by the proteasome ppt
... glioma-associated protein SETA interacts with AIP1/ Alix and ALG-2 and modulates apoptosis in astrocytes J Biol Chem 275, 19275–19281 14 Watanabe, S., Take, H & Takeda, K., Yu, Z.X., Iwata, N & Kajigaya, ... that lactacystine and the peptide aldehyde ALLN inhibit proteasome- mediated proteolysis, causing an accumulation of proteins that are usually degraded by this pathway [22] In contrast to lactacystine, ... N-Ac-Leu-Leu-norLeucinal (ALLN) and lactacystin were purchased from Sigma and Calbiochem, respectively Rabbit polyclonal anti-hemagglutinin (HA) Ig and anti-Cbl Ig were purchased from Santa Cruz...
- 7
- 317
- 0
Báo cáo khoa học: Amyloid structure – one but not the same: the many levels of fibrillar polymorphism potx
... accumulation of amyloid per se that is pathological, leading to organ failure and eventual death [5–7] Smaller amounts of amyloids accumulated in sensitive locations, such as the cornea, can also lead to ... use as functional amyloid, serving as structural anchoring material for a range of purposes ranging from biofilm formation to a matrix to anchor melanin as well as for the reduction of interfacial ... exponentially growing type Bagitated fibril structure Data from thermal melting suggest that type A fibrils are relatively unstable compared with type Bagitated app fibrils, with apparent thermal melting...
- 11
- 400
- 0
Báo cáo khoa học: Insulin is a kinetic but not a thermodynamic inhibitor of amylin aggregation pot
... was incubated with amylin to evaluate its effect on amylin aggregation Samples were incubated at 37 °C for 72 h with shaking, and were taken for ThT assays, light scattering assays and HPLC analysis ... acetonitrile and 0.006% trifluoroacetic acid Absorbance was measured at 280 nm, and the flow rate was 0.3 mL ⁄ Statistical analysis Data from three independent experimental groups are presented as mean values ... believed that insulin serves as an important biological factor that inhibits amylin aggregation [10,11] Early studies claimed that insulin might act as a natural inhibitor under normal circumstances...
- 7
- 388
- 0
Báo cáo khoa học: Novel isoenzyme of 2-oxoglutarate dehydrogenase is identified in brain, but not in heart potx
... Yoshimura Y, Yamazaki N, Yoshimura Y, Yamauchi T, Kataoka M, Nagata T, Terada H et al (2006) VDAC1, having a shorter N-terminus than VDAC2 but showing the same migration in an SDS–polyacrylamide gel, ... spectra was performed by the use of data analysis software package and biotools software from Bruker A peptide mass tolerance of ± Da, a fragment mass tolerance of ± Da and one maximal missed cleavage ... OGDHL_rat_h OGDH_rat_h OGDH_rat_b OGDHL_rat_b * QRATKEASVGPAQPQPP -AVIQESRASVSSCTKTSKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSF RNTNAGAPPGTAYQSPLSLSRSSLATMAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSS...
- 17
- 389
- 0
Báo cáo khoa học: The activation of gelsolin by low pH The calcium latch is sensitive to calcium but not pH docx
... parameters (apparent dissociation constant Kd and the maximal binding Amax) were determined by nonlinear fitting: A ¼ Amax  ½L=ðKd þ ½LÞ ð1Þ where, A is the absorbance at 405 nm and L the ligand concentration, ... parameters Kd (apparent dissociation constant) and Amax (maximum effect) were calculated by nonlinear fitting of the experimental data points as for ELISA (Eqn 1) or by using the following equation: ... domains were coated onto plastic and the binding of biotinylated G2 domain was revealed by using alkaline phosphatase labeled streptavidin Figure shows that binding occurs with similar a nity at...
- 8
- 320
- 0
Social capital and Health status: a protective impact among elderly or inactive but not among active ? doc
... self-assessed health status and to have a regular social participation on whole population Finding indicates that after instrumentation, social capital (that is to say having a regular social participation) ... health to explain health disparities Social capital is actually considered as a potential explanatory factor of an individual’s health status since social interaction, trust and reciprocity facilitate ... strongly associated with social participation among both populations To have spoken in French and another language increases the probability to have a regular social participation for both active and...
- 27
- 465
- 0
Tìm thêm: xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo gắn với các giáo trình cụ thể tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008