... COMPASS, COMPASS English as a Second Language (ESL), ASSET, and “Combined English Language Skills Assessment” (CELSA).4 The COMPASS ESL and CELSA tests were used only for ESL students The CELSA ... under this subpart of (1) The test taken by the student; (2) The date ofthe test; and (3) The student 's scores as reported by the test publisher, assessment center, or State Students Ineligible ... 16 students, the assessment center manually scored the tests For five of those eight students, the assessment center did not ensure that the tests were administered by certified test administrators...
... required the USMS to ask permission each day the USMS needed to use the system Ultimately, the FBI disabled five USMS radios because it said there was too much traffic The USMS Chief Inspector for the ... status of these components' LMRs follows 19 For purposes of this audit, obsolete systems are systems that are no longer supported by the manufacturer or the manufacturer is unable to supply spare ... that they can be received by the other systems This allows the agencies to continue using their existing systems but requires twice as much spectrum because each system occupies separate channels...
... instant the canoe glided into the obscurity ofthe shadows cast by the overhanging trees With the disappearance of Darius there came upon me the full sense of my responsibility, for I was the ... Yankees, an' the other is sneakin' in some corner!" There came the sound of hurried footsteps, and then the light ofthe lantern so far illumined the head ofthe stairway that I could see Darius, ... it as tough as is deserved These others are prisoners of war; but you two are traitors and spies, therefore must expect to fare according to your deserts." "That 's about the size of it, Amos,"...
... sequence {ui } of Γ-admissible solutions of (1.13) has a subsequence which satisfies the conclusions of Corollary 4.7, since the proof just relies on the results of Section and Lemma 4.2 For the ... for other symmetricfunctions As we observed in the remarks following the proofs of Propositions 3.2 and 3.3, any Γ-admissible solution of (1.13) automatically satisfies the conclusions of Lemma ... Γ-admissible solutions ˜ Furthermore, suppose {ui } is a sequence of solutions to Ψti [ui ] = 0, as described in Section 2.1 Then the conclusion of Proposition 4.1 also holds for this sequence, since...
... Blatty s adaptation of his novel THE EXORCIST (1973) is the scariest movie made on the subject of demonic possession It has had the most psychological impact on its a udience since its release ... think of ourselves as masters of our universe: we’ve landed on the Moon, split the atom, and tamed the beasts of nature Seeing ourselves as anything less than perfect or at the bottom ofthe food ... imprison us and frustrate our curiosity about the infinite osmic spaces beyond the radius of c our sight and analysis These stories frequently emphasise the element of horror because fear is our...
... consider themselves masters ofthe situation Most ofthe citizens had now deserted Rawn; some because they believed the Indians had escaped and that there would be no fight, others because they ... the soldiers saw the smoldering camp-fires ofthe enemy; heard the baying of his hungry dogs responding to the howls of prowling coyotes, and saw, by the flickering lights, the smoky lodges ofthe ... arm." Some ofthe Indians had, at the first alarm, mounted their horses, and rode rapidly to the hills on either side and to depressions in the open prairies ofthe valley From these positions, as...
... constructs The extent of increased apoptosis among DP9-expressing cells was similar to the extent ofthe adhesion deficit This concordance of apoptosis and adhesion suggests that one may cause the other ... overexpression increased stuarosporine streptomyces (STS)-induced apoptosis The actin cytoskeleton was unaffected by DP8 or DP9 overexpression We investigated whether some ofthe effects seen on ... Plus Confocal Scanning System (Bio-Rad, Hercules, CA) and lasersharp 2000 software Apoptosis Statistics As described previously [12], 293T cells were transfected with CFP fusion constructs, replated...
... types: linguistic awareness, psycholinguistic awareness, discourse awareness, communicative awareness, sociolinguistic awareness and strategic awareness • Linguistic awareness where the aim is ... confirms that writing itself is an act of discovery and that writers invent or discover the specific words, details and syntactic structures as they write 2.3 Models ofthe Writing Process Research ... randomization process later on) to be given the questionnaire The aim ofthe learners’ questionnaire is to gauge the students’ level of awareness ofthe writing process and the writing techniques underlying...
... citizen Their registration as such confirms the special status of charities as organisations dedicated to furthering the public benefit ofthe disadvantaged and in the eyes of society confers upon them ... fulfill the terms ofthe donor s gift The duty resting on trustees to honour the terms of their trust and ensure that the objects ofthe charity prevail has always been seen as the primary means whereby ... of general utility,16 for hospitality,17 for such societies as should be in the opinion of trustees ‘most in need of help’18 and for such purposes, civil or religious, as a class of persons should...
... Descriptions Task Task Description Propulsion The MSL propulsion subsystem comprises two independently operated subsystems: cruise stage (CS) propulsion and the descent stage (DS) The CS propulsion subsystem ... incurring the resultant costs, NASA s Associate Administrator for the Science Mission Directorate should reassess the sufficiency ofthe Project s funding based on our calculations In addition, the MSL ... Project s history of cost estimation, reassess the sufficiency of available reserves, and adjust funding accordingly Management s Response The Associate Administrator for the Science Mission Directorate...
... KLKEGICEALEDSGGRQDSAAWDLPQQAHQP TEPEPVTIKIKDLLSCSNFAVQHRFLFEEDN LSRSTQKLFHSTKSSGNPLEE ELKVQICEALRNSAHQQHLSSGRLHRTNPQPSGPESTTVEITDVLACPSLAIQHKYLFEDSQSHSTRTTAKT ATEEARRLVSTEDA DIEEARSLISIEDA RATTSSLVTDEEA PEEGISAGTELRSP ... proteolytic processing of matn-1 either in the presence or absence of serum, as did 100 μM actinonin (Fig 6D) This suggests that cleavage by matrix proteases is responsible for the generation ofthe 26 ... residues) To test this hypothesis, these four amino acid residues were deleted from the junction site, and the resulting cDNA Δmatn-1Del was transfected into COS cells (Fig 6A) Δmatn-1Del still...
... biological osteosynthesis has gained a reputation in fracture treatment Minimally invasive plate osteosynthesis (MIPO) techniques minimize the extent of soft tissue trauma to the injury zone, theoretically ... techniques of internal fixation This unusual case of delayed union ofthe femur fracture associated with Paget 's disease ofthe bone for which functional bracing was ultimately successful illustrates ... involving the entire femur ofthe fracture (Figure 5), the patient is able to walk unaided with a single T-cane Discussion Although Paget 's disease ofthe bone is a relatively common disease in Australia,...
... entire functions in the whole complex s- plane see 14–16 Journal of Inequalities and Applications Various kinds ofthe q-analogue ofthe Genocchi numbers and polynomials, recently, have been studied ... polynomials and their interpolation functions He also gave many applications of these numbers and functions He 14 defined qextension Genocchi polynomials of higher order He gave many applications and ... polynomials at negative integers Finally, we also give some identities related to these polynomials Modified Generating Functionsof Higher Order q-Genocchi Polynomials and Numbers In this section, we study...
... (3 cycles of CHOP) The pathological diagnosis ofthe second HNC in all the cases (2 cases of cancer ofthe gum, case of tongue cancer, and case of maxillary sinus cancer) was SCC (fig 2) The median ... by the nature ofthe tumor, but also by several patient factors, mainly the extent ofthe existing tissue damage Because ofthe small number of cases, we could not estimate the prognosis of second ... diseases such as tuberculous lymphadenitis, skin diseases, thyroid diseases and spondylitis, however, at present, RT is mainly used to treat malignancies The limitation ofthe prior disease treated...
... remained disease-free for six months after diagnosis Based on these findings, a diagnosis of Ewing s sarcoma ofthe calcaneus was made Discussion Ewing s sarcoma is a rare malignant neoplasm, predominantly ... patients ofthe ages five to 20 years It involves the diaphyses of long bones and occurs Figure CT image ofthe patient s foot, revealing a soft-tissue mass originating from the calcaneus, permeative ... ofthe patient s foot shows a hypointense tumor mass on T1-weighted spin-echo sequences compared to surrounding musculature The skip lesion ofthe talus displays a hyposignal on T1-weighted sequences...
... where they migrate towards the epidermis This hypothesis is supported by the association between Paget s and an underlying breast carcinoma in the majority of patients The second hypothesis, the ... nuclei [1,2] The pathogenesis of Paget s disease is still a subject of debate with two main hypotheses The epidermotropic hypothesis proposes that Paget s cells originate from ductal epithelium, ... Paget s disease ofthe right nipple with no evidence of underlying invasive ductal carcinoma, ductal carcinoma in situ ofthe breast tissue or lymph node invasion Discussion Paget s disease is an...
... non-Hodgkin s lymphoma with synchronous perforation Tumors ofthe small intestine are infrequent; only 3% to 6% of gastrointestinal tumors and 1% of gastrointestinal malignances arise from the small ... http://www.jmedicalcasereports.com/content/5/1/57 diagnosis was made Other symptoms include bleeding, obstruction, perforation, and intussusceptions No sex predominance exists Some patients remain asymptomatic ... perforation to the time of operation can affect the outcome Pre-operative shock is also a significant poor prognostic factor for such patients Conclusions Surgeons should always be alert for the possibility...
... and sclerosis Squamous and goblet cell metaplasia in the ductal system Stage (end-stage): Cirrhosis-like, with marked parenchymal loss and sclerosis (the “burnt out” phase) Our case corresponded ... 2011 Published: 29 March 2011 References Seifert G, Donath K: [On the pathogenesis ofthe Küttner tumor ofthe submandibular gland-Analysis of 349 cases with chronic sialadenitis ofthe submandibular.] ... nodules of our case to be similar to follicular hyperplasia, which is characterized by the presence of progressive transformation ofthe germinal centers In such progressive transformation, it is...
... alendronate seemed to be more suitable for the treatment of Japanese patients since the dose of alendronate used for the treatment of osteoporosis in Japanese patients (5 mg per day) was half of that used ... other sclerosing bone dysplasia [2,3] To monitor disease activity and the effects of treatment, we measured T-ALP and uNTX levels of our patients every three to six months and assessed their ... throughout the five-year follow-up Recently, several studies have indicated the possibility that long-term or high-dose bisphosphonate therapy could cause severe side effects, including osteonecrosis of...