g protein coupled receptors diverse functions and shared mechanisms of action interpreted through the structure of rhodopsin
Báo cáo y học: " Signaling and regulation of G protein-coupled receptors in airway smooth muscle" ppsx
Ngày tải lên :
13/08/2014, 13:20
... region of G and causes the dissociation of G from the G γ dimer The G and G subunits are tightly associated and remain anchored into the lipid bilayer due to the prenylation of the G subunit ... recently discovered RGS (regulators of G protein signaling) proteins [107] Experimental manipulation of RGS protein expression can alter GPCR signaling, but the physiologic role of RGS proteins is unclear ... http://www.respiratory-research/content/4/1/2 Figure Gi -coupled receptor signaling in airway smooth muscle Gi -coupled receptors have the capacity to initiate or modulate signaling through the actions of both Gi-derived α and βγ subunits...
- 23
- 363
- 0
CHARACTERIZATION OF g PROTEIN COUPLED RECEPTORS THROUGH THE USE OF BIO AND CHEMO INFORMATICS TOOLS
Ngày tải lên :
31/10/2015, 10:39
... experimental structure of the templates The procedure of the webserver is described in the Fig III APPLICATION FOR HOMOLOGY MODELING AND ODOR LIGAND DOCKING OF THE MOUSE ODOR RECEPTOR MOR174-9 The mouse ... method of choice for identifying and aligning templates for homology modeling [14] These 44 TP DUY, A GIORGETTI, NHH CHUONG, P CARLONI, H ZUNG methods are used by many of the best protein structure ... CHARACTERIZATION OF G PROTEIN COUPLED RECEPTORS 47 Fig The lowest Autodock VINA affinity of docked ligands generated by the receptor built by template 3rze, although their DOPE and GA341 scores are not the best...
- 7
- 298
- 0
Báo cáo khoa học: Allosteric functioning of dimeric class C G-protein-coupled receptors doc
Ngày tải lên :
07/03/2014, 21:20
... trans-activation occurs in the GABAB receptor, GABA binding in the GABAB1 VFT leading to activation of the GABAB2 HD Although GABAB1 VFT binds the agonist and the GABAB2 HD couples to G- protein, a chimeric ... functioning of these receptors offers a number of possibilities for allosterically regulating 2953 Class C G- protein- coupled receptors their activity using compounds acting at various sites of the ... because the agonist binding domain and the G- protein coupling domain are part of the same subunit Coupling between ligand binding and HD activation has also been recently examined in the homodimeric...
- 9
- 315
- 0
Báo cáo khoa học: Methods to monitor the quaternary structure of G protein-coupled receptors doc
Ngày tải lên :
16/03/2014, 22:20
... identification of potential protein protein interaction sites in GPCR dimers [22,23] and determining whether ligand-binding modulates the organizational structure of a GPCR dimer ⁄ oligomer Although the ... that oligomerization of the partners is not promoted by the bivalent nature of the antibodies In studies assessing the effect of ligand-binding on the quaternary structure of the receptors, the possibility ... stoichiometry of the fusion proteins allowing the G protein fused to one receptor to interact with the G protein of another receptor -G protein fusion that may or may not be part of the same oligomer...
- 12
- 337
- 0
báo cáo khoa học: " Nucleoside conjugates of quantum dots for characterization of G protein-coupled receptors: strategies for immobilizing A2A adenosine receptor agonists" pdf
Ngày tải lên :
11/08/2014, 00:22
... loading of the drug/ligand onto the surface, by preconjugation to the dendron spacer Thus, it was necessary to greatly enhance the water solubility of the QD by changing the surface chemistry TA groups ... expressing the human A AR The binding affinity (n = 3-5) and was determined by using 2A agonist radioligands [3H]CGS21680 The concentrations of the ligand complexes were measured by the concentration ... Each tube in the binding assay contained 100 μL of membrane suspension (20 g of protein) , 50 μL of agonist radioligand, and 50 μL of increasing concentrations of the test ligands in Tris-HCl buffer...
- 19
- 194
- 0
Báo cáo khoa học: Activation of nematode G protein GOA-1 by the human muscarinic acetylcholine receptor M2 subtype Functional coupling of G-protein-coupled receptor and G protein originated from evolutionarily distant animals doc
Ngày tải lên :
07/03/2014, 11:20
... gagcagaagctgatctccgaggaggacctgctgGTGAACAACTCCAC CAACTCCTCCAACAACTCCCTGGCTCTTACAAGTC CTTATAAGACA-3¢; HsM2-as, 5¢-TTACCTTGTAGCG CCTATGTTCTTATAATG-3¢ (An engineered EcoRI recognition site is single-underlined ... using total RNA separated from mix stage of C elegans as a template with the following primers: M2-goa1-s, 5¢-CATTATAAGA ACATAGGCGCTACAAGGATGGGTTGTACCATGTC ACAGGAAG-3¢; M2-goa1-PstI-as, 5¢-CCAATGCATTGG ... 5¢-CCAATGCATTGG TTCTGCAGTTAATACAAGCCGCATCCACGAAGA-3¢ (An engineered PstI recognition site is single-underlined The overlapping region to the C-terminus of M2 is doubleunderlined.) The cDNAs encoding M2(N-D)I3del...
- 9
- 400
- 0
Báo cáo khoa học: G protein-coupled receptor-induced Akt activity in cellular proliferation and apoptosis pptx
Ngày tải lên :
16/03/2014, 05:20
... investigate the ability of GPCRs to activate Akt signaling pathways both directly, through the interaction of Gbc subunits with PI3K, and indirectly, through the GPCR transactivation of RTKs and ... at the plasma membrane either through matrix metalloproteinases (Gi ⁄ o-, Gq-, and Gs -coupled receptors) or through Rho ⁄ Rho-associated kinase (Rock)-mediated expression of RTK ligands (G1 2 ... activation G1 2 ⁄ 13-, Gi ⁄ o-, Gq-, and Gs -coupled receptors are all known to activate the phosphoinositide 3-kinase (PI3K) ⁄ Akt pathway through either Ga or Gbc subunits Gaq and Gas subunits...
- 12
- 392
- 0
Báo cáo khoa học: G protein-coupled receptor 30 down-regulates cofactor expression and interferes with the transcriptional activity of glucocorticoid pdf
Ngày tải lên :
16/03/2014, 18:20
... sites The following primers were used for cloning at the pLEGFP-N1 vector: GPR30-forward 5¢-TAATAAGTCGACGGGTC TCTTCCT-3¢ and GPR30-reverse 5¢-ATTATTGGATC CTACACGGCACTGC-3¢ Viruses capable of introducing ... 5¢-ATCTCCAAGGCAA GATCA-3¢ and reverse primer 5¢-GTGCCATCAGA CAAGGAA-3¢ were used Primer pair resulted in a PCR product of 216 bp Additionally, forward primer 5¢-GAGCCCCAAGAAGAAAGA-3¢ and reverse ... control GPR30 C TIF-2 C GPR30 Fig GPR30 down-regulates the expression of TIF2 protein The regulation of cofactor was studied in HME cells stably expressing GPR30 The relative expression of TIF2...
- 10
- 389
- 0
Báo cáo khoa học: The impact of G-protein-coupled receptor hetero-oligomerization on function and pharmacology pptx
Ngày tải lên :
16/03/2014, 22:20
... coexpressing both receptors, even though they may form hetero-oligomers [5] The same phenomenon has been shown to occur in hetero-oligomers formed by Gi -coupled and Gq -coupled receptors [6] and by Gs -coupled ... interaction and ERK1 ⁄ signaling is shown in Fig Regardless of the mechanism by which b-arrestins bind to GPCRs, the signaling pathway activated by these proteins is another way by which GPCR heterooligomerization ... of the ligand affinity for the hetero-oligomer At most, it may represent an average measure of all the different affinities that the ligand expresses for the binding site(s) of both hetero-oligomers...
- 8
- 488
- 0
Báo cáo khoa học: The study of G-protein coupled receptor oligomerization with computational modeling and bioinformatics doc
Ngày tải lên :
16/03/2014, 22:20
... locations on TM5 and TM6 of most aminergic receptors was interpreted to suggest the involvement of these helices in the dimerization of the aminergic receptors, whereas TM4 and TM5 were suggested to ... how G protein- coupled receptors transduce the signal to the G protein Proteins 52, 553–560 Madabushi S, Gross AK, Philippi A, Meng EC, Wensel TG & Lichtarge O (2004) Evolutionary trace of G protein- coupled ... swapping in G- protein coupled receptor dimers Prot Eng 11, 1181–1193 Gouldson PR, Higgs C, Smith RE, Dean MK, Gkoutos GV & Reynolds CA (2000) Dimerization and domain swapping in G- protein- coupled receptors: ...
- 13
- 515
- 0
Báo cáo khoa học: The variable C-terminal extension of G-protein-coupled receptor kinase 6 constitutes an accessorial autoregulatory domain ppt
Ngày tải lên :
07/03/2014, 12:20
... P2, 5¢-ACTGTCGCTGGAGTTCCCAGAGGAATCTTGG CG-3¢ (nucleotides 1677–1709, antisense) Complementary DNAs encoding the C-terminal mGRK6-A mutants M2 and M3 were prepared either from the mGRK6-A mutant ... [35] Members of the GRK4 subfamily, GRK4, GRK5 and GRK6, contain neither a CAAX motif nor a G protein bc dimer-binding domain in the variable region of the C-terminal region, but nevertheless exhibit ... mRNAs encoding four distinct mouse GRK6 isoforms (mGRK6), designated mGRK6-A to -D [7] Analysis of the genomic organization of the mouse GRK6 gene showed that the four mRNAs are generated by...
- 13
- 424
- 0
Báo cáo khoa học: Identification of sites of phosphorylation by G-protein-coupled receptor kinase 2 in b-tubulin ppt
Ngày tải lên :
17/03/2014, 09:20
... phosphorylation of tubulin may affect physiological processes including GPCRs, and the interaction of GRK2 with tubulin may have an effect on the function of GRK2 Acknowledgements We thank Professor ... Sites of phosphorylation by GRK2 in tubulin (Eur J Biochem 270) 1159 Fig Phosphorylation by GRK2 of GST fusion proteins of bI-tubulin and bIII-tubulin (GST-b-tubulin) and the C-terminal peptide of ... followed by SDS/PAGE, and radioactivity counting of the tubulin band Molar concentrations of fusion proteins were calculated from the molecular mass: GST, 27.5 kDa; GST-bI-tubulin and GST-bIII-tubulin,...
- 10
- 267
- 0
Báo cáo Y học: Progestin upregulates G-protein-coupled receptor 30 in breast cancer cells pot
Ngày tải lên :
24/03/2014, 00:21
... The following primers (Amersham Pharmacia Biotech) were used for PCR: GPR30-forward, 5¢-AGTCGG ATGTGAGGTTCAG-3¢; GPR30-reverse, 5¢-TCTGTGT GAGGAGTGCAAG-3¢; TBP-forward, 5¢-TTTGGAAG AGCAACAAAGG-3¢; ... 5¢-TTTGGAAG AGCAACAAAGG-3¢; TBP-reverse, 5¢-AAGGGTGCAG TTGTGAGAG-3¢ TBP was used to normalize the RNA samples These primer pairs result in PCR products of 240 bp (GPR30) and 243 bp (TBP) LightCycler data ... Differences of P < 0.05 were considered significant (*), and P < 0.01 (**) and P < 0.001 (***) highly significant RESULTS Cloning of genes, the expression of which is altered during progestin-induced growth...
- 6
- 425
- 0
Báo cáo sinh học: " Kaposi''''s sarcoma associated herpesvirus G-protein coupled receptor activation of cyclooxygenase-2 in vascular endothelial ce" pptx
Ngày tải lên :
18/06/2014, 18:20
... (BABE-vGPCR) expressing vGPCR upstream of the coding sequence for green fluorescent protein (GFP) so that the bicistronic transcript mRNA should lead to the dual expression of vGPCR and GFP (Figure ... secretion and tumorigenesis, leading to significant retardation in tumor growth [33] Whether induction of COX-2 leads to the angiogenic and tumorigenic effects of vGPCR is currently under investigation ... viable therapeutic strategy to abrogate PGE2 secretion since prostaglandin E synthase (PGES) cannot synthesize PGE2 without PGH2 and there are no direct inhibitors of PGES currently available Given...
- 9
- 458
- 0
Báo cáo hóa học: " Kaposi''''s sarcoma associated herpesvirus G-protein coupled receptor activation of cyclooxygenase-2 in vascular endothelial cells" ppt
Ngày tải lên :
20/06/2014, 01:20
... (BABE-vGPCR) expressing vGPCR upstream of the coding sequence for green fluorescent protein (GFP) so that the bicistronic transcript mRNA should lead to the dual expression of vGPCR and GFP (Figure ... secretion and tumorigenesis, leading to significant retardation in tumor growth [33] Whether induction of COX-2 leads to the angiogenic and tumorigenic effects of vGPCR is currently under investigation ... viable therapeutic strategy to abrogate PGE2 secretion since prostaglandin E synthase (PGES) cannot synthesize PGE2 without PGH2 and there are no direct inhibitors of PGES currently available Given...
- 9
- 327
- 0
Báo cáo y học: "Novel G-protein-coupled receptor-like proteins in the plant pathogenic fungus Magnaporthe grisea" pot
Ngày tải lên :
14/08/2014, 14:21
... EFSFWGQIYGYLSAILYLGSRLPQLLLNFRRKSTEGVSMLFFLFACLGNLTYVLSILAYDGS -SECAAGPGDCEDGEPGQ -EFNILGQVFGWLCAVLYLGSRVPQILLNYRRKSTEGVSMLFFLFACLGNLTYVLSIFAFEPRCRDKHSGIGPHAGGCVGGEAGR SQEPQAVIGMILGYFSAVCYLCARIPQIIKNYREKSCEGLALLFFLLSLTGNLTYGASVIAY ... TPIAESIAVYVFGALIYASKIPERWYPGCFDYFGGSHNLWHLAVLGGIVFHYIAMQE GLSASGFLPIFQIWLTRGGMSVWEHY SPILESLFVYFLGALVYASKVPERWCPGMFDYVGGSHNLWHMAVLGGILFHYNAMQE GLGASLFLPLAHGLSVLGWKRLDAAMGLESFLGLAAINFSGSAVYAMRIPERWFPGTFDLIGQSHNWMHVLVLTGALVRLNGLIR ... GLGASLFLPLAHGLSVLGWKRLDAAMGLESFLGLAAINFSGSAVYAMRIPERWFPGTFDLIGQSHNWMHVLVLTGALVRLNGLIR GLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSN GLGLSGVVPVVHAVGEDGFAALDERMGLKWVMLQGAMYIFGAFIYAARWPERSFPGKFDIWCSSHQIFHIFVLLAAASHLYGMIK...
- 14
- 242
- 0
Báo cáo khoa học: Functions and cellular localization of cysteine desulfurase and selenocysteine lyase in Trypanosoma brucei pot
Ngày tải lên :
22/03/2014, 21:20
... analysis of the total cell lysate and the mitochondrial and cytosolic fractions, tagged protein is detected only in the cytosolic fraction, which is composed of nuclei and the cytosol (Fig 4A) Polyclonal ... the TAP tag study This work was supported by the Grant Agency of the Czech Republic 204 ⁄ 09 ⁄ 1667, the Ministry of Education of the Czech Republic (LC07032 and 2B06129 and 6007665801) and the ... vector containing a 415 bp fragment of the SCL gene The criterion for the selection of this fragment was the lowest possible sequence similarity to the Nfs gene Transfection of the procyclics...
- 11
- 326
- 0
Calculus: An Integrated Approach to Functions and their Rates of Change, Preliminary Edition Part 116 pdf
Ngày tải lên :
05/07/2014, 18:20
... log of x, 442 Negative numbers, 95 Net change with constant rate of change, 712–714 difference between left- and right-hand sums and, 718–722 explanation of, 712 with nonconstant rate of change, ... cubics and, 373–377 degree of, 380, 1063 of even and odd degrees, 385 explanation of, 373, 379–380, 385–386, 1063 graphs of, 384–385, 391–399 long division of, 383 overview of, 373 zeros of, 380–383, ... 935 Taylor’s Theorem convergence and, 962 definition of, 935 proof of, 1127–1128 use of, 934–935, 937, 942 Temperature change, 73–74 Theon of Alexandria, 95n Theorem on Differentiation of Power Series,...
- 10
- 564
- 1
Calculus: An Integrated Approach to Functions and their Rates of Change, Preliminary Edition Part 1 pps
Ngày tải lên :
05/07/2014, 18:20
... Gottlieb Preface The concepts of calculus are intriguing and powerful Yet for a learner not fluent in the language of functions and their graphs, the learner arriving at the study of calculus poorly ... types of functions, facilitating the accumulation of a robust set of problem-solving skills, and strengthening the students as learners of mathematics and science An integrated course offers freedom, ... underpinnings This text grew out of an integrated calculus and precalculus course Three general principles informed the creation of both the course and the text Developing mathematical reasoning and...
- 10
- 639
- 0