example of a pr campaign plan

Tài liệu How to Plan a PR Campaign docx

Tài liệu How to Plan a PR Campaign docx

Ngày tải lên : 23/12/2013, 00:15
... effectiveness of a PR campaign? Find out at How to Plan a PR Campaign. How to Plan a PR Campaign is an intensive two-day seminar designed to show communications professionals how to plan, implement and ... should a really top notch PR plan contain? What do the professionals include? This session takes you thr ough all the critical stages of planning a PR campaign: ã The essential stages of planning a ... W rite a PR Plan What should a PR plan look like? What should it say? This session explains the practicalities of sitting down and writing a full-blown PR campaign: ã How to write a PR plan a step-by-step...
  • 4
  • 669
  • 0
Tài liệu Elements of a PR Plan pptx

Tài liệu Elements of a PR Plan pptx

Ngày tải lên : 23/12/2013, 00:15
... In addition to an ongoing public relations campaign it may be necessary to reach out to head off any negative publicity caused by lack of accurate information. Examples of appropriate use of ... addition to the traditional array of print and broadcast sources, for dissemination of news and information. Every organization should have a program to stay in touch regularly with appropriate ... transparencies. Press packages may include black-and-white photos and state that color material also is available via your Web site’s press section. Audio Tapes for Radio Audio tapes are rarely used, but can...
  • 15
  • 432
  • 1
Báo cáo y học: "A Comparative Effectiveness Study of Bone Density Changes in Women Over 40 Following Three Bone Health Plans Containing Variations of the Same Novel Plant-sourced Calcium"

Báo cáo y học: "A Comparative Effectiveness Study of Bone Density Changes in Women Over 40 Following Three Bone Health Plans Containing Variations of the Same Novel Plant-sourced Calcium"

Ngày tải lên : 25/10/2012, 11:10
... Kaats GR was the principal investigator; he se- cured and audited all study data, conducted all of the statistical analyses, and contributed significantly to the preparation and submission of ... following all three plans had an increase in MAPC: Plan 1=1.30%, Plan 2=2.00%, and Plan 3=4.1%. Using a repeat- ed-measures t-test, the MAPC from baseline in all three Plans was significant (P=0.003, ... Subjects in all three plans had an increase in MAPC: Plan 1=1.20%, Plan 2=0.33%, and Plan 3=2.5%. Using a repeated measures t-test, MAPC in Plan 1 and 3 were significant (P=0.027 and P=0.002...
  • 12
  • 663
  • 0
A LIST OF SOME PR FUNCTIONS

A LIST OF SOME PR FUNCTIONS

Ngày tải lên : 17/10/2013, 12:15
... advance for management of the crisis and the primary goal of this strategy should be the protection of participants, spectators and participating institutions. Having a strategy set in advance ... organizations and interest groups are "battling" for space or airtime. Press Releases Press releases help inform media of team-related news and events and can serve as a summary prior ... enter the data in and analyze if you have access to SPSS. If you do not have access to SPSS, the data can also be converted to other data analysis programs by your campus research department....
  • 6
  • 365
  • 0
Tài liệu Advertising and PR campaign of Mobifone docx

Tài liệu Advertising and PR campaign of Mobifone docx

Ngày tải lên : 21/01/2014, 03:20
... services providers seem to competed by value added services Advertising and PR campaign Advertising and PR campaign Media Media For For MCA service and MCA service and MobiFone MobiFone WEAKNESSES  ... Its automatically. Media Ads PR Creative Marketing Strategy Creative Creative For For MCA service and MCA service and MobiFone MobiFone MARKETING Strategies: ִUndertake TET promotion program: ... Strategy Marketing Strategy For For MCA service and MCA service and MobiFone MobiFone PR campaign PR campaign For For MCA service and MCA service and MobiFone MobiFone STRENGTHS  One of the...
  • 45
  • 460
  • 0
Tài liệu Báo cáo khoa học: C-Terminal extension of a plant cysteine protease modulates proteolytic activity through a partial inhibitory mechanism doc

Tài liệu Báo cáo khoa học: C-Terminal extension of a plant cysteine protease modulates proteolytic activity through a partial inhibitory mechanism doc

Ngày tải lên : 14/02/2014, 14:20
... aa 208 aa 24 aa BamH 34 aa Start Stop Xho1 N -Pro Protease domain Protease domain CT - ex 380 aa 1 II NP 114 aa 208 aa BamH1 34 aa Start Stop Xho1 SS SS G SSS S N-Pro 356 aa III MSTLFII S ILLFLAS F SYAMDI S TIEYKYDKSS AWRTDEEVKEIYELWLAKHDKVY SG LVEYEKRFEIFKDNLKFIDEH NSENHTYKMGLTPYTDLTNEEFQAIYLGTRSDTIHRLKRTINISERYAYEAGDNLPEQIDWRKKGAVTPVKNQGKCG SCWAFSTVSTVESINQIRTGNLISLSEQQLVDCNKKNHG CKGGAFVYAYQYIIDNGGIDTEANYPYKAVQGPCRAAK KVVRIDGYKGVPHCNENALKKAVASQPSVVAIDASSKQF QHYKSGIFSGPCGTKLNHGVVIVGYWKDYWIVRNSW GRYWGEQGYIRMKRVGGCGLCGIARLPYYPTKA AGDENSKLETPELLQWSEEAFPLA IV A B 66 ... rmErv-C +CT . Because Erv-C isolated from the latex of the same plant does not show the CT-extension, the possibility 19 aa 114 aa 208 aa 24 aa Pre N-Pro Protease domain CT - ex 365 aa H1 I N Pro CT ex 114 aa 208 ... Nakamura K & Matsuoka K (1993) Protein targeting to the vacuole in plant cells. Plant Physiol 101, 1–5. 10 Okamoto T, Yuki A, Mitsuhashi N & Mimamikawa T (1999) Asparaginyl endopeptidase...
  • 13
  • 759
  • 0
Tài liệu Báo cáo khoa học: Crystal structure of Klebsiella sp. ASR1 phytase suggests substrate binding to a preformed active site that meets the requirements of a plant rhizosphere enzyme doc

Tài liệu Báo cáo khoa học: Crystal structure of Klebsiella sp. ASR1 phytase suggests substrate binding to a preformed active site that meets the requirements of a plant rhizosphere enzyme doc

Ngày tải lên : 16/02/2014, 09:20
... QuikChange site-directed mutagenesis kit (Stratagene, La Jolla, CA, USA). Plasmid pET-1TK was used as template and Kleb(HtoA)fw (5Â-GCTTAGCCGCGCCGGCATTCG) and Kleb(HtoA)rv (5Â-CGAATGCCGGCGCGGCTAAGC) ... groups of HAPs are adapted to different habitats. To support plant growth, bacteria do not need to release phosphate as fast as the diges- tive tract of an animal host, where possible substrates might ... similarity, the overall structure of Klebsiella phytase bears similar- ity to other histidine-acid phosphatases, such as E. coli phytase, glucose- 1-phosphatase and human prostatic-acid phosphatase....
  • 13
  • 766
  • 0
Tài liệu Báo cáo khoa học: Spectroscopic characterization of a higher plant heme oxygenase isoform-1 from Glycine max (soybean) ) coordination structure of the heme complex and catabolism of heme docx

Tài liệu Báo cáo khoa học: Spectroscopic characterization of a higher plant heme oxygenase isoform-1 from Glycine max (soybean) ) coordination structure of the heme complex and catabolism of heme docx

Ngày tải lên : 19/02/2014, 05:20
... oxyheme appeared at 540 and 579 nm. Then, a broad band appeared at around 660 nm, and was maximal 9–12 min after initiation of the reaction. The spectral features of the final reaction mixture were analogous, ... the axial heme ligand in rat heme oxygenase-1. Arch Biochem Biophys 317, 253–258. 21 Chu GC, Katakura K, Tomita T, Zhang X, Sun D, Sato M, Sasahara M, Kayama T, Ikeda-Saito M & Yoshida T ... coli. Plant Physiol 97, 1495–1401. 40 Onda Y, Matsumura T, Kimara-Ariga Y, Sakakibara T, Sugiyama T & Hase T (2000) Differential interaction of maize root ferredoxin:NADP + oxidoreductase with photosynthetic...
  • 16
  • 617
  • 0
The impact of a cancer Survivorship Care Plan on gynecological cancer patient and health car provider reported outcomes (ROGY Care): study protocol for a pragmatic cluster randomized controlled trial potx

The impact of a cancer Survivorship Care Plan on gynecological cancer patient and health car provider reported outcomes (ROGY Care): study protocol for a pragmatic cluster randomized controlled trial potx

Ngày tải lên : 05/03/2014, 15:20
... status, and clinical variables such as cancer stage at diagnosis, time after diagnosis, and initial treat- ment. All measures will be collected at the beginning of the trial, and at 6, 12, 18 and ... Providing information that i s congruent with a patient ’sneedsat that particular time is an important determinant for patient satisfaction and affects health-related quality of life (HRQoL) and anxiety and ... sum- marize characteristics of both hospitals and patients. Characteristics of patients (i.e ., age, type of cancer, stage, treatment, so cio-economic status, marital statu s, educational level,...
  • 8
  • 786
  • 0
Báo cáo khoa học: Crystal structure and enzymatic properties of a bacterial family 19 chitinase reveal differences from plant enzymes pdf

Báo cáo khoa học: Crystal structure and enzymatic properties of a bacterial family 19 chitinase reveal differences from plant enzymes pdf

Ngày tải lên : 07/03/2014, 11:20
... L, Hamid Q & Elias JA (2004) Acidic mammalian chitinase in asthmatic Th2 inflammation and IL-13 pathway activation. Science 304, 1678– 1682. 4 Kasprzewska A (2003) Plant chitinases ) regulation ... equal amounts of (GlcNAc) 3 and (GlcNAc) 2 ; the 80 : 20 anomeric ratio of the products indicates that cleavage after sugar 2 or sugar 3 occurs approxi- mately equally often. Structure The overall ... Bio-Rad Protein Assay Kit (Bio-Rad, Hercu- les, CA, USA) with BSA as a standard. Analyses of the specific activity against chitooligosaccha- rides were performed in 100 lL reaction mixtures con- taining...
  • 12
  • 399
  • 0
Báo cáo khoa học: Epl1, the major secreted protein of Hypocrea atroviridis on glucose, is a member of a strongly conserved protein family comprising plant defense response elicitors potx

Báo cáo khoa học: Epl1, the major secreted protein of Hypocrea atroviridis on glucose, is a member of a strongly conserved protein family comprising plant defense response elicitors potx

Ngày tải lên : 07/03/2014, 12:20
... [e.g. cerato-platanin of Ceratocystis fimbriata f. sp. platani, Snodprot1 of Phaeosphaeria nodorum and Sp1 of Leptosphaeria maculans) or human allergens and path- ogenesis-related proteins (As-CG of ... several proprietary and public genomic databases using a tailor-made bioinformat- ics facility. The mascot search was run against all proteins and DNA sequence information from public databases V. ... conidia and hyphae of Ceratocystis fimbriata f. sp. Platani. FEMS Microbiol Lett 233, 341–346. 25 Pazzagli L, Cappugi G, Manao G, Camici G, Santini A & Scala A (1999) Purification, characterization,...
  • 14
  • 494
  • 0
Báo cáo khoa học: Two types of replication protein A in seed plants Characterization of their functions in vitro and in vivo ppt

Báo cáo khoa học: Two types of replication protein A in seed plants Characterization of their functions in vitro and in vivo ppt

Ngày tải lên : 07/03/2014, 21:20
... (ATGGAGAACTCAGT GACCCAAGATGGTAT) and 70b R1 (AGAATTCTGAG GTTGAAGAAGCTAGTAA) primers, and 70b F2 (TACT ATCAGCAGAAGCAATGTGGTGATA) and 70b R2 (TTACTGAGATGTCTTGTTCTTGGAAATGT) primers for atrpa70b. As a control, A. thaliana ... (TGT AACCGAGATGGTCGGCAAC) and AtRPA7 0a- 3Â (AA CAGTCATCTTCACTCTTTGT); AtRPA70b-5Â (TTCAA CTTTGTACCCATTGAT) and AtRPA70b-3Â (TTCACCG CCATTATATACCTTA). These primers were used to obtain a fragment of 722 bp ... (AtRPA7 0a and AtRPA70b) A. thaliana was used for genetic analysis of the functions of OsRPA7 0a and OsRPA70b because it has closely rela- ted homologs (AtRPA7 0a and AtRPA70b, respectively) and because...
  • 12
  • 588
  • 0
Báo cáo khoa học: Purification of a plant nucleotide pyrophosphatase as a protein that interferes with nitrate reductase and glutamine synthetase assays pdf

Báo cáo khoa học: Purification of a plant nucleotide pyrophosphatase as a protein that interferes with nitrate reductase and glutamine synthetase assays pdf

Ngày tải lên : 08/03/2014, 08:20
... (NR) was highly purified from cauli- flower (Brassica oleracea var. botrytis) extracts. The final preparationcontainedanacyl-CoAoxidaseandasecond protein of the plant nucleotide pyrophosphatase family. ... the amounts and concentrations of ATP and NADH used in standard GS and NR assays, respectively. Data are presented as mean ± SEM. Cofactor AMP generated (nmol) % cofactor hydrolysed to AMP None 0.4 – ATP ... oleracea var. botrytis) extracts. The final preparation contained an acyl-CoA oxidase and a second protein of the plant nucleotide pyrophosphatase family. Nucleotide pyrophosphatases belong to a family...
  • 7
  • 457
  • 0

Xem thêm